PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS103979 to PF04286 (DUF445)

VIMSS103979 has 374 amino acids

Query:       DUF445  [M=367]
Accession:   PF04286.12
Description: Protein of unknown function (DUF445)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.8e-79  253.6   9.3    3.2e-79  253.4   9.3    1.0  1  VIMSS103979  


Domain annotation for each sequence (and alignments):
>> VIMSS103979  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  253.4   9.3   3.2e-79   3.2e-79       1     366 [.      12     373 ..      12     374 .] 0.95

  Alignments for each domain:
  == domain 1  score: 253.4 bits;  conditional E-value: 3.2e-79
       DUF445   1 aeaAliGaladwfAikaLFRhP.....lg.lpiPfttglIPknkeriakklgnfVeehLLtkeslakkLkeaevasklaewlk.........nptnke 83 
                  +++A+iG++++ +Ai++LF+ P     ++ +++Pft+glIPk++e+ia k+g+++eehLLt+  +++kLk+++ ++++ ++++         +     
  VIMSS103979  12 VVGAIIGGITNVIAIRMLFH-PfkpyyIFkFRVPFTPGLIPKRREEIATKIGQVIEEHLLTETLINEKLKSEQSQQAIESMIQqqlqkltkdQ----- 103
                  58******************.**************************************************************8885555551..... PP

       DUF445  84 sl.........aaiveellkeiledlddesikellkknlkkkleevipepllgkllellleeerhkkllddlldriknllkdeevkekikelidelie 172
                   l           ++e++l+   ++++++++++++ k  +++++++ p++l+  l      ++++++++d l+dr++n+l++ +++++i++++d ++ 
  VIMSS103979 104 -LsikqitsqiDIDLEQVLQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFL------DQHVDNATDLLCDRARNYLSSAKGTQDINDMLDTFFH 194
                  .35555555559999****************************************......************************************* PP

       DUF445 173 eesgklvlesivsmflreltsilekvksdpdhllreeedkkvreliadllndpelaakveklkkkklsdlevqeyeealwealkdlllkdlneeesll 270
                  e+ gk  l ++ +mf+++ +si++++++++ +l+++ + ++    +++l++     ++++++k+k l++l  + + +++ e+l+  +++++++   + 
  VIMSS103979 195 EK-GK--LIGMLQMFMTK-ESIADRIQQELIRLTSHPKART---IVTSLIT-----NEYQTFKDKPLNELLDASQFNEIAENLSVYVTTYASN---QA 277
                  99.77..9**********.********99999999999999...*******.....9***********************************9...68 PP

       DUF445 271 rerisklleklgeklaed..pklreklnkflenaaakvlekyrldiskiveetvnafdaeeleelIelivgkeLqaIrinGtlvGgliGlllylvsll 366
                  ++++ +l+ ++++ l+ +  +kl++ ++++l+ +++++++k  +d+  ++ee++n+fd +++e+lI++i++keL++I+ +G ++Gg+iG+++ lv+ +
  VIMSS103979 278 NKPVVTLMPQFVDYLEGQlsSKLANLIIEKLSIHLSTIMKK--VDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILGGIIGFFQGLVAIF 373
                  *****************************************..***************************************************9876 PP



Or compare VIMSS103979 to CDD or PaperBLAST