PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10401970 to PF04286 (DUF445)

VIMSS10401970 has 423 amino acids

Query:       DUF445  [M=367]
Accession:   PF04286.12
Description: Protein of unknown function (DUF445)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
   6.3e-110  354.4   1.4   7.9e-110  354.1   1.4    1.0  1  VIMSS10401970  


Domain annotation for each sequence (and alignments):
>> VIMSS10401970  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  354.1   1.4  7.9e-110  7.9e-110       1     365 [.      44     416 ..      44     417 .. 0.99

  Alignments for each domain:
  == domain 1  score: 354.1 bits;  conditional E-value: 7.9e-110
         DUF445   1 aeaAliGaladwfAikaLFRhPlglpiP...fttglIPknkeriakklgnfVeehLLtkeslakkLkeaevasklaewlknptnkeslaaiveell 93 
                    aeaA++GaladwfA++aLFR+   +p+P    +t++IP+nk+ri+++lg+fV+e++L+++sl + ++++e+a  +++w ++p+n+ ++ +++ +++
  VIMSS10401970  44 AEAAMVGALADWFAVVALFRR---VPLPfisRHTAIIPRNKDRIGENLGQFVQEKFLDTQSLVALIRRHEPALLIGKWFSQPENAGRIGQHLLQIM 136
                    69******************9...99996667**************************************************************** PP

         DUF445  94 keiledlddesikellkknlkkkleevipepllgkllellleeerhkkllddlldriknllkdeevkekikelidelieeesgklv........le 181
                    ++ le +dd +i++llk++++k +++v+++++ + +le +++++rh++lld+l+ ++ +ll+++ +++ i++ i +++e+e++  +         e
  VIMSS10401970 137 SGFLELTDDARIQRLLKRAVHKAIDKVDLSGTGALMLESMTKNDRHQALLDTLIAQLIALLQRDTSRKFIARQIVHWLETEHPLKAkilptewlGE 232
                    ***********************************************************************************999********** PP

         DUF445 182 sivsmflreltsilekvksdpdhllreeedkkvreliadllndpelaakveklkkkklsdlevqeyeealwealkdlllkdlneeesllreriskl 277
                    + ++ + ++++s+l+++  d +h++r+++d++  +li++l++dp++aa++e +k+++ +d++ ++y+ +lw++l+++l++d+n ++s +++ri+++
  VIMSS10401970 233 HSAELVSDAVNSLLDDISLDRAHQIRHAFDRATFRLIDKLKSDPDMAARAESIKDYLKEDETFNRYLGELWDDLRQWLKNDINADDSRVKQRIANA 328
                    ************************************************************************************99********** PP

         DUF445 278 leklgeklaedpklreklnkflenaaakvlekyrldiskiveetvnafdaeeleelIelivgkeLqaIrinGtlvGgliGlllylvsl 365
                     +++ge+l+ d++lr++ln +le+aa++v+++++  +++++++tv+++d+++++++Iel++gk+Lq+Ir+nGtlvGg iGlllyl+s+
  VIMSS10401970 329 GQWFGETLIADEALRASLNGHLEQAAHRVAPEFATFLTRHISDTVKSWDPRDMSRQIELNIGKDLQFIRVNGTLVGGTIGLLLYLLSQ 416
                    **************************************************************************************97 PP



Or compare VIMSS10401970 to CDD or PaperBLAST