PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS18360 to PF04286 (DUF445)

VIMSS18360 has 426 amino acids

Query:       DUF445  [M=367]
Accession:   PF04286.12
Description: Protein of unknown function (DUF445)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
   4.1e-112  361.6   1.6   4.7e-112  361.4   1.6    1.0  1  VIMSS18360  


Domain annotation for each sequence (and alignments):
>> VIMSS18360  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  361.4   1.6  4.7e-112  4.7e-112       1     366 [.      44     417 ..      44     418 .. 0.99

  Alignments for each domain:
  == domain 1  score: 361.4 bits;  conditional E-value: 4.7e-112
      DUF445   1 aeaAliGaladwfAikaLFRhPlglpiP...fttglIPknkeriakklgnfVeehLLtkeslakkLkeaevasklaewlknptnkeslaaiveellkei 96 
                 aeaA++GaladwfA++aLFR+   +piP    +t++IP+nk+ri+++lg+fV+e++L+++sl + ++++e+a  +++w ++p+n++++ +++ +++++ 
  VIMSS18360  44 AEAAMVGALADWFAVVALFRR---VPIPiisRHTAIIPRNKDRIGENLGQFVQEKFLDTQSLVALIRRHEPALLIGNWFSQPENARRVGQHLLQIMSGF 139
                 69******************9...9999999******************************************************************** PP

      DUF445  97 ledlddesikellkknlkkkleevipepllgkllellleeerhkkllddlldriknllkdeevkekikelidelieeesgklv........lesivsmf 187
                 le +dd +i++llk+++++ +++v+++++ + +le +++++rh+ lld+l+ ++ +ll+++++++ i++ i +++e+e++  +         e+ ++ +
  VIMSS18360 140 LELTDDARIQRLLKRAVHRAIDKVDLSGTSALMLESMTKNDRHQVLLDTLIAQLIALLQRDKSRKFIAQQIVRWLESEHPLKAkilptewlGEHSAELV 238
                 ********************************************************************************999**************** PP

      DUF445 188 lreltsilekvksdpdhllreeedkkvreliadllndpelaakveklkkkklsdlevqeyeealwealkdlllkdlneeesllrerisklleklgekla 286
                  ++++s+l+++ +d +h++r+++d++   li++l+ndpe+aa+++++k ++ +d++ ++y+++lw +l+++l+ d+n+e+s ++eri+++ +++ge+l+
  VIMSS18360 239 SDAVNSLLDDISRDRAHQIRHAFDRATFALIDKLKNDPEMAARADAVKSYLKEDEAFNRYLSELWGDLREWLKVDINSEDSRVKERIARAGQWFGETLI 337
                 ******************************************************************************99******************* PP

      DUF445 287 edpklreklnkflenaaakvlekyrldiskiveetvnafdaeeleelIelivgkeLqaIrinGtlvGgliGlllylvsll 366
                  d++lr++ln +le+aa++v++++++ +++++++tv+++da++++++Iel++gk+Lq+Ir+nGtlvGg+iGl+lyl+s+l
  VIMSS18360 338 ADDALRASLNGHLEQAAHRVAPEFSAFLTRHISDTVKSWDARDMSRQIELNIGKDLQFIRVNGTLVGGCIGLILYLLSQL 417
                 *****************************************************************************986 PP



Or compare VIMSS18360 to CDD or PaperBLAST