PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS187119 to PF04286 (DUF445)

VIMSS187119 has 499 amino acids

Query:       DUF445  [M=367]
Accession:   PF04286.12
Description: Protein of unknown function (DUF445)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   5.2e-110  354.7  26.8   3.2e-108  348.8  26.8    2.7  1  VIMSS187119  


Domain annotation for each sequence (and alignments):
>> VIMSS187119  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  348.8  26.8  3.2e-108  3.2e-108       2     367 .]      10     498 ..       9     498 .. 0.94

  Alignments for each domain:
  == domain 1  score: 348.8 bits;  conditional E-value: 3.2e-108
       DUF445   2 eaAliGaladwfAikaLFRhP.....lg.lpiPfttglIPknkeriakklgnfVeehLLtkeslakkLkeaevasklaewlk.........nptnkes 84 
                  ++A+iG++++w+Aik+LFR P     ++ +++Pft+glIPk+k+ria+k+g++V++hLL+++sl+k+Lk+++++sk++e++k         n+t +es
  VIMSS187119  10 IGAVIGYITNWLAIKMLFR-PreakyIFgMKLPFTPGLIPKEKSRIANKVGETVGTHLLNSDSLSKALKDDKIKSKFNEVAKekinqvinsNSTLEES 106
                  8******************.******888**********************************************************99997777777 PP

       DUF445  85 l........................aaiveellkeiledlddesikellkknlk...........................................k 115
                  l                        ++i+ee++k++l++++++sike+l+kn+k                                            
  VIMSS187119 107 LkntlgenyyalkgnminniaktilESIQEEEFKNKLKFYIVDSIKERLNKNPKkiidfinsnkfreviintleeektrdiigkallkevktlekedL 204
                  7888899999999999999999999************************************************************************* PP

       DUF445 116 kleevipepllgkllellleeerhkkllddlldriknllkdeevkekikelidelieeesgklvlesivsmflreltsilekvksdpdhllreeedkk 213
                  ++eevipe++++++      ee++k+++d+l+d+iknll+d+ev++kik++i+++         ++sivsmfl++ ++i++k+ s +d++l+eee+k+
  VIMSS187119 205 TIEEVIPENIKPYI------EEYVKSQKDTLVDIIKNLLRDDEVSYKIKSAINDN---------IPSIVSMFLSG-DVIYGKLVSLVDKSLSEEENKE 286
                  **************......***********************************.........8999*******.********************** PP

       DUF445 214 vreliadllndpelaakveklkkkklsdlevqeyeea...lwealkdlllkdlneeesllrerisklleklge......................... 283
                     +i+d++      a+v++++kkk+sd++++++ee+   +++al d+++k+ln+ee +++++iskl++k+++                         
  VIMSS187119 287 ---YICDAAL-----AFVHESMKKKVSDVINNVGEEKlevISDALGDKISKKLNTEE-NIDSIISKLNCKISSfnsyeeiikvlfndyenilidnids 375
                  ...*******.....****************************************99.**************************************** PP

       DUF445 284 .............................klaedpklrekln.......................kflenaaakvlekyrldiskiveetvnafdaee 329
                                               +                                   +f+en++akvle+  +dis+ivee++naf++++
  VIMSS187119 376 misqivnnnqlsgeiskiiekvfdkflqnS-----------LndicynkqnlensimsildnlynDFVENKSAKVLEI--VDISSIVEEQINAFEVDY 460
                  *********999999955555555555550...........345555555555555555555556*************..****************** PP

       DUF445 330 leelIelivgkeLqaIrinGtlvGgliGlllylvslli 367
                  +ee+I++i++keL+aI+++G+l+Gg++G+l++l+s+++
  VIMSS187119 461 AEEIIIGIANKELKAITWLGALLGGILGILSPLLSTIY 498
                  ***********************************986 PP



Or compare VIMSS187119 to CDD or PaperBLAST