PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2093270 to PF04286 (DUF445)

VIMSS2093270 has 228 amino acids

Query:       DUF445  [M=367]
Accession:   PF04286.12
Description: Protein of unknown function (DUF445)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.9e-25   75.1   2.8    1.8e-15   43.7   0.1    2.1  2  VIMSS2093270  


Domain annotation for each sequence (and alignments):
>> VIMSS2093270  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   43.7   0.1   1.8e-15   1.8e-15       5      77 ..      37     106 ..      36     133 .. 0.83
   2 !   31.5   0.6   8.8e-12   8.8e-12     274     363 ..     141     227 ..     136     228 .] 0.86

  Alignments for each domain:
  == domain 1  score: 43.7 bits;  conditional E-value: 1.8e-15
        DUF445   5 liGaladwfAikaLFRhPlglpiPfttglIPknkeriakklgnfVeehLLtkeslakkLkeaevasklaewlk 77 
                   l Gal++w+Ai +LF +   +p+ +  g+IP++ e + +++ ++++e++++++ l++ Lk+++++  la+ ++
  VIMSS2093270  37 LSGALTNWIAIYMLFEK---IPFLYGSGIIPNKFESFKRAIKKMIMEQFFSPQNLNNFLKSDDIKRYLADNIA 106
                   55**************6...455589***************************************99988776 PP

  == domain 2  score: 31.5 bits;  conditional E-value: 8.8e-12
        DUF445 274 isklleklgeklaed.pklreklnkflenaaakvlekyrldiskiveetvnafdaeeleelIelivgkeLqaIrinGtlvGgliGlllylv 363
                   ++ l e + +kl  +  +l+++++    n+++k++ek    i++++ +++++  +++++e+I+ i+++ L + ++ G++ GgliGl+   +
  VIMSS2093270 141 LEGLREPFTKKLDSKvIELLSSIDINTNNISQKAAEK----IERLIDSRLDELTPQMVKEIIQRIIREHLGWLVVWGGVFGGLIGLAASFI 227
                   5556677777888888888888888888888888888....********************************************987665 PP



Or compare VIMSS2093270 to CDD or PaperBLAST