PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS312263 to PF04286 (DUF445)

VIMSS312263 has 234 amino acids

Query:       DUF445  [M=367]
Accession:   PF04286.12
Description: Protein of unknown function (DUF445)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.2e-22   67.3   0.9    4.5e-13   35.8   0.2    2.1  2  VIMSS312263  


Domain annotation for each sequence (and alignments):
>> VIMSS312263  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   30.4   0.0   1.9e-11   1.9e-11       7      65 ..      36      91 ..      33      99 .. 0.92
   2 !   35.8   0.2   4.5e-13   4.5e-13     268     363 ..     140     233 ..     111     234 .] 0.89

  Alignments for each domain:
  == domain 1  score: 30.4 bits;  conditional E-value: 1.9e-11
       DUF445  7 GaladwfAikaLFRhPlglpiP..fttglIPknkeriakklgnfVeehLLtkeslakkLke 65
                 Ga+++w+Ai +LF      ++P  +  g+IP + e++  ++ n  +e+++t+e + k L +
  VIMSS312263 36 GAITNWLAIHMLFE-----KVPglYGSGVIPARFEEFKAAIKNLMMEQFFTSENIDKFLSK 91
                 9*************.....588889******************************999976 PP

  == domain 2  score: 35.8 bits;  conditional E-value: 4.5e-13
       DUF445 268 sllrerisklleklgeklaedpklreklnkflenaaakvlekyrldiskiveetvnafdaeeleelIelivgkeLqaIrinGtlvGgliGlllylv 363
                  + l++++ + +++ +  l++++++++ l+++le    +++e+ +++i+ i+ +++n+  ++ ++e++++++++ L + ++ G++ GgliG++  +v
  VIMSS312263 140 IPLKQPFVEKMQQAMVDLSHSDTIKQALKEELEA--PAMMEEIQQNIENIIDQRLNELTPKLVKEMVQKMIKQHLGWLVVWGGVFGGLIGVITSVV 233
                  5678888999999999**************9985..56899999**********************************************887765 PP



Or compare VIMSS312263 to CDD or PaperBLAST