PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS314319 to PF04286 (DUF445)

VIMSS314319 has 376 amino acids

Query:       DUF445  [M=367]
Accession:   PF04286.12
Description: Protein of unknown function (DUF445)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.9e-82  262.7  10.6    5.6e-82  262.5  10.6    1.0  1  VIMSS314319  


Domain annotation for each sequence (and alignments):
>> VIMSS314319  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  262.5  10.6   5.6e-82   5.6e-82       1     366 [.      12     375 ..      12     376 .] 0.96

  Alignments for each domain:
  == domain 1  score: 262.5 bits;  conditional E-value: 5.6e-82
       DUF445   1 aeaAliGaladwfAikaLFRhP.....lg.lpiPfttglIPknkeriakklgnfVeehLLtkeslakkLkeaevasklaewlk.........nptnke 83 
                  + +A+iG++++++Aik+LF+ P     ++ ++iPft+glIPk++e+ia+k+g+++eehL+t+e +++kL++ +  ++++++++         +     
  VIMSS314319  12 ILGAIIGGVTNMIAIKMLFH-PfkpyyIFrFRIPFTPGLIPKRREEIARKIGQVIEEHLITEELIRQKLNQPQSRNMIQQLIHkqisklkndD----- 103
                  579*****************.**************************************************************8776665552..... PP

       DUF445  84 sl.........aaiveellkeiledlddesikellkknlkkkleevipepllgkllellleeerhkkllddlldriknllkdeevkekikelidelie 172
                   +           +v+el++ +l++ + ++++ ++++n+ +kl+e+ p+ +l+++      +++++ ++d l++r++n+l++e+++++i e++d +++
  VIMSS314319 104 -VtikkiagflGIDVNELVDYKLTTKFLNKLNFWYESNKYRKLSEILPQSFLDQC------KGQIEYITDFLCERARNYLSSEKGERDIYEMLDTFFN 194
                  .2444455666********************************************......************************************* PP

       DUF445 173 eesgklvlesivsmflreltsilekvksdpdhllreeedkkvreliadllndpelaakveklkkkklsdlevqeyeealwealkdlllkdlneeesll 270
                  e+ g+  + ++ +mf+++ +si++++++++ +l+++ +++k    i+++ln     +++e +k+k l++++++++ ++ ++ + + l+++ln ++   
  VIMSS314319 195 EK-GR--IIGLLQMFMTK-ESIADRIQHELIRLTQHPQSQK---IITKVLN-----DEYEIFKDKNLDEIIKEQQFKNYSQLVLNELKTYLNLKD-KT 279
                  **.77..9**********.**********************...*******.....9************************************99.** PP

       DUF445 271 rerisklleklgeklaed..pklreklnkflenaaakvlekyrldiskiveetvnafdaeeleelIelivgkeLqaIrinGtlvGgliGlllylvsll 366
                  +++i++++ ++++ l++d  +++ + ++k  +++++++++k   ++ ++vee++n+fd +++e+lI++i++keL++I+ +G ++Gg+iG+++ +++ +
  VIMSS314319 280 ERPIKQVVPQFIQFLEDDtsKRMTDFIIKGTSKHLTNIMKK--INLRQLVEEQINTFDLKYIENLIIDIANKELKLIMTLGFILGGIIGFFQGVIAIF 375
                  *******************9*********************..*************************************************999876 PP



Or compare VIMSS314319 to CDD or PaperBLAST