PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS520057 to PF04286 (DUF445)

VIMSS520057 has 422 amino acids

Query:       DUF445  [M=367]
Accession:   PF04286.12
Description: Protein of unknown function (DUF445)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
     7e-104  334.5   0.4     8e-104  334.4   0.4    1.0  1  VIMSS520057  


Domain annotation for each sequence (and alignments):
>> VIMSS520057  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  334.4   0.4    8e-104    8e-104       1     366 [.      56     418 ..      56     419 .. 0.99

  Alignments for each domain:
  == domain 1  score: 334.4 bits;  conditional E-value: 8e-104
       DUF445   1 aeaAliGaladwfAikaLFRhPlglpiPfttglIPknkeriakklgnfVeehLLtkeslakkLkeaevasklaewlknptnkeslaaiveellkeile 98 
                  aea+++G+ladwfA++aLFR+Plgl+iP +t+l++++k++++++l++fV e++L++  +++k+++a+v + la+wl +p+n++++++++ ++++++++
  VIMSS520057  56 AEAGMVGGLADWFAVTALFRYPLGLKIP-HTALVRNKKDQVGESLSSFVSENFLNPTLITQKVRQAQVPTVLADWLVQPDNAKRVSQEAGTFVAKVVR 152
                  69**************************.********************************************************************* PP

       DUF445  99 dlddesikellkknlkkkleevipepllgkllellleeerhkkllddlldriknllkdeevkekikelidelieeesgklvlesivsmflreltsile 196
                  +ld ++ + +++++l +kl++ ++ p +gk l++l++e+  ++++d+l  ++++  +++e+   i +++de+++++ ++++++ ++++++rel++++ 
  VIMSS520057 153 ALDPQDAETVINAALLDKLAQPEWGPHVGKTLQQLIDEGLTDPIVDQLAGWMHKKATTSEAL--IIRILDERAPSWAPRFINDIVGERVYRELVQWTA 248
                  **************************************************************..********************************** PP

       DUF445 197 kvksdpdhllreeedkkvreliadllndpelaakveklkkkklsdlevqeyeealwealkdlllkdlneeesllrerisklleklgeklaedpklrek 294
                   v++d++h++r+++++++++++ dl++dp +++kve++k++ + +  v++ + ++w++ ++++l+++++ es +r++i++   ++ge++ +d+++r++
  VIMSS520057 249 AVDRDKNHEARHAIRRFLEKFAVDLQEDPVMIQKVEEIKHDIMGSGPVRNAAASIWASTSSAILAAVADPESIIRTKIAEYAMAWGERIHNDEQIRTQ 346
                  *********************************************************************77*************************** PP

       DUF445 295 lnkflenaaakvlekyrldiskiveetvnafdaeeleelIelivgkeLqaIrinGtlvGgliGlllylvsll 366
                  l++++  aa+ ++e+y+++i++i+ et++++da+e++++Iel+vgk+Lq+Ir nGt+vG+l+Gl++y+vs l
  VIMSS520057 347 LDRRITGAAEFLAENYADQITSIIGETIERWDADEASDKIELMVGKDLQYIRLNGTVVGALAGLAIYTVSYL 418
                  *********************************************************************976 PP



Or compare VIMSS520057 to CDD or PaperBLAST