PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5915497 to PF04286 (DUF445)

VIMSS5915497 has 434 amino acids

Query:       DUF445  [M=367]
Accession:   PF04286.12
Description: Protein of unknown function (DUF445)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
   1.6e-106  343.2   0.1   1.8e-106  343.0   0.1    1.0  1  VIMSS5915497  


Domain annotation for each sequence (and alignments):
>> VIMSS5915497  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  343.0   0.1  1.8e-106  1.8e-106       1     366 [.      68     430 ..      68     431 .. 0.99

  Alignments for each domain:
  == domain 1  score: 343.0 bits;  conditional E-value: 1.8e-106
        DUF445   1 aeaAliGaladwfAikaLFRhPlglpiPfttglIPknkeriakklgnfVeehLLtkeslakkLkeaevasklaewlknptnkeslaaiveellkeil 97 
                   aea++iG+ladwfA++aLFRhPl lpiP +t++IP++k++++++l+ fV++++L+++ +++k+ +a + ++++ewl++p+n e+++++v +l ++i+
  VIMSS5915497  68 AEAGMIGGLADWFAVTALFRHPLWLPIP-HTAIIPRKKDQLGEALSGFVGDNFLNAQLITEKVSQARIPERAGEWLAQPENGEKVSREVGKLTANIV 163
                   69**************************.******************************************************************** PP

        DUF445  98 edlddesikellkknlkkkleevipepllgkllellleeerhkkllddlldriknllkdeevkekikelidelieeesgklvlesivsmflreltsi 194
                   +++d ++ ++++k+++ +kl+e  + p +g+lle+ll+e+++++++++l +++++    +e    i++l++e+++ + +k+  + ++ ++++e+ ++
  VIMSS5915497 164 RAIDPSDAEAVIKSAVIDKLAEPTWGPPAGRLLEQLLAEGKAEPVVQELAQWLHKKALGSEPL--IDRLLNERRPIWAPKFTAQLVSGKVYDEVIKF 258
                   ***************************************************************..******************************** PP

        DUF445 195 lekvksdpdhllreeedkkvreliadllndpelaakveklkkkklsdlevqeyeealwealkdlllkdlneeesllrerisklleklgeklaedpkl 291
                   +e v +dp+h++r+++++++++l++dl++dp ++ kve++k++ + + + ++ + ++w+++++ l +++++e+s lr++i+++ +++g++l  d+ l
  VIMSS5915497 259 TEAVAADPNHEARKSLRRFLNKLAQDLQHDPGMIIKVEEIKRDIMGSGAIAQAAPTIWASASESLIESAEDESSILRRKIAEAATSWGQRLLVDDSL 355
                   ***********************************************************************77************************ PP

        DUF445 292 reklnkflenaaakvlekyrldiskiveetvnafdaeeleelIelivgkeLqaIrinGtlvGgliGlllylvsll 366
                   r++l+ ++  aaa ++++y+ +++ i++et++++daee++e+Iel+vgk+Lq+Ir nGt+vG+l+Gl++y++s++
  VIMSS5915497 356 RHSLDTRITGAAAFLADNYAPEVTGIISETIERWDAEEASEKIELMVGKDLQYIRLNGTIVGALAGLAIYAISHI 430
                   *************************************************************************98 PP



Or compare VIMSS5915497 to CDD or PaperBLAST