PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS664684 to PF04286 (DUF445)

VIMSS664684 has 377 amino acids

Query:       DUF445  [M=367]
Accession:   PF04286.12
Description: Protein of unknown function (DUF445)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.7e-79  253.7   8.4      3e-79  253.5   8.4    1.0  1  VIMSS664684  


Domain annotation for each sequence (and alignments):
>> VIMSS664684  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  253.5   8.4     3e-79     3e-79       1     367 []      12     377 .]      12     377 .] 0.96

  Alignments for each domain:
  == domain 1  score: 253.5 bits;  conditional E-value: 3e-79
       DUF445   1 aeaAliGaladwfAikaLFRhP.....lg.lpiPfttglIPknkeriakklgnfVeehLLtkeslakkLkeaevasklaewlk.........nptnke 83 
                  ++++ iGa+++ +Ai++LFR P     l+  ++Pft+glIPk+++++a+++g++V +hLLt++ ++++L ++++++++++ ++         ++t +e
  VIMSS664684  12 VIGGFIGAMTNYIAIRMLFR-PykaiyLFnKRLPFTPGLIPKRRDELAEHIGKVVVSHLLTEDAIRARLLDENLQKEITDTITkmfhekmqlETTPNE 108
                  58******************.**************************************************************888877776556666 PP

       DUF445  84 sl....aaiveellkeiledlddesikellkknlkkkleevipepllgkllellleeerhkkllddlldriknllkdeevkekikelidelieeesgk 177
                   l     +++e     ++e++ +++i+++l +++++k++++ip+ l+++l       ++ +++++ +  ++  ++++ee+k +ik+++++++ee+ gk
  VIMSS664684 109 LLhhfgYENAEIRSMTWVEKTLEKEINHFLTTKKTTKMSDLIPTMLESEL------TTKLPHVTERITSKMTLFVSSEEGKIQIKQMLQKFFEEH-GK 199
                  6699988888888899**********************************......***************************************.77 PP

       DUF445 178 lvlesivsmflreltsilekvksdpdhllreeedkkvreliadllndpelaakveklkkkklsdlevqeyeealwealkdlllkdlneeesllreris 275
                     +s+++mf++  +s+ ek++++  +l+ +e +k+   li++ll+     ++++++  k l++l+ +e++ +l  +l++ l + + +e+ l++++i+
  VIMSS664684 200 --MGSMARMFINI-DSFSEKIQQEGLKLIGQEDTKN---LINQLLT-----TEWKNFEAKELQELIPTEKQAHLAGQLTSELIQTFPHEK-LFNQPIQ 285
                  ..8*********9.**********************...*******.....*************************************88.******* PP

       DUF445 276 klleklgeklaed..pklreklnkflenaaakvlekyrldiskiveetvnafdaeeleelIelivgkeLqaIrinGtlvGgliGlllylvslli 367
                   +l+ ++++++e+  p   e++ +f+ +++a+++e+   d++k+ve+++++f+  e+e+l+ +i+g+eL++I+++G+++Gg+iG+++ +++ +i
  VIMSS664684 286 VMLRGYEAAITEKviPFAVERMLDFVATHSAEIVER--MDLAKLVETQIATFSLPEIEKLVVEISGRELKMITYLGGILGGFIGIIQGVLAMWI 377
                  ************************************..*************************************************9998875 PP



Or compare VIMSS664684 to CDD or PaperBLAST