PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS148674 to PF04338 (DUF481)

VIMSS148674 has 252 amino acids

Query:       DUF481  [M=212]
Accession:   PF04338.12
Description: Protein of unknown function, DUF481
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.5e-59  186.5  10.8      4e-59  186.3  10.8    1.0  1  VIMSS148674  


Domain annotation for each sequence (and alignments):
>> VIMSS148674  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  186.3  10.8     4e-59     4e-59       2     211 ..      48     251 ..      47     252 .] 0.98

  Alignments for each domain:
  == domain 1  score: 186.3 bits;  conditional E-value: 4e-59
       DUF481   2 elGlslktGNtettslnaalklkrrtgrwrlslkaeyeygesngettaekyrvslqydyklserlylfalgsyetDrfsgldsratlgaGlGyrlidt 99 
                  ++G+ +++GNt+++sl+a++ +++  +r+ +sl++++ +++sn+e+++eky v ++ + ++++  y f+++s+ tDrf+g+++r +l aG+G+++++ 
  VIMSS148674  48 NAGYLAQSGNTKSSSLTADTAMTWYGQRTAWSLWGNASNTSSNDERSSEKYAVGARNRFNMTDYDYTFGQASWLTDRFNGYRQRDVLTAGYGRQFLNG 145
                  79************************************************************************************************ PP

       DUF481 100 dktklsleaGpgyrytkytdeeeeedeeevilrlsldyeykisdnvsftqdlevevnleggsnttlrsetgltvkltdalslkisyevdydsdppe.g 196
                  + +++++e Gpg+ry++ td+    +e++  + +s +y ++++dn++ftq ++v +   g+++ttl+set+l+v +++++ lk+ y+++++s+ppe  
  VIMSS148674 146 PVHSFRFEFGPGVRYDEHTDD---TTETQPLGYASGSYAWQLTDNAKFTQGVSV-F---GAEDTTLNSETALNVAINEHFGLKVGYNLTWNSQPPEsA 236
                  ********************9...******************************.5...7************************************77 PP

       DUF481 197 kkktDtrlsvsLvys 211
                   ++tD+r++v+L+y+
  VIMSS148674 237 PEHTDRRTTVTLGYK 251
                  8*************8 PP



Or compare VIMSS148674 to CDD or PaperBLAST