PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS15840 to PF04338 (DUF481)

VIMSS15840 has 252 amino acids

Query:       DUF481  [M=212]
Accession:   PF04338.12
Description: Protein of unknown function, DUF481
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    5.1e-59  186.0  10.4    5.8e-59  185.8  10.4    1.0  1  VIMSS15840  


Domain annotation for each sequence (and alignments):
>> VIMSS15840  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  185.8  10.4   5.8e-59   5.8e-59       2     211 ..      48     251 ..      47     252 .] 0.98

  Alignments for each domain:
  == domain 1  score: 185.8 bits;  conditional E-value: 5.8e-59
      DUF481   2 elGlslktGNtettslnaalklkrrtgrwrlslkaeyeygesngettaekyrvslqydyklserlylfalgsyetDrfsgldsratlgaGlGyrlidtd 100
                 ++G+ +++GNt+++sl+a++++++   ++ +sl++++ +++sn+e+++eky + ++++ +l++  ylf+++s+ tDr++g++ r +l aG+G+++++ +
  VIMSS15840  48 NAGYLAQSGNTKSSSLTADTTMTWYGHTTAWSLWGNASNTSSNDERSSEKYAAGGRSRFNLTDYDYLFGQASWLTDRYNGYRERDVLTAGYGRQFLNGP 146
                 79************************************************************************************************* PP

      DUF481 101 ktklsleaGpgyrytkytdeeeeedeeevilrlsldyeykisdnvsftqdlevevnleggsnttlrsetgltvkltdalslkisyevdydsdppe.gkk 198
                  +++++e Gpg+ry+kytd+    +e++  + +s  y ++++dn++ftq ++v +   g+++ttl+se +l+v +++++ lk++y+v+++s+ppe   +
  VIMSS15840 147 VHSFRFEFGPGVRYDKYTDN---ASETQPLGYASGAYAWQLTDNAKFTQGVSV-F---GAEDTTLNSESALNVAINEHFGLKVAYNVTWNSEPPEsAPE 238
                 ********************...******************************.5...7************************************778* PP

      DUF481 199 ktDtrlsvsLvys 211
                 +tD+r+++sL+ys
  VIMSS15840 239 HTDRRTTLSLGYS 251
                 ************8 PP



Or compare VIMSS15840 to CDD or PaperBLAST