PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS217052 to PF04338 (DUF481)

VIMSS217052 has 375 amino acids

Query:       DUF481  [M=212]
Accession:   PF04338.12
Description: Protein of unknown function, DUF481
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-55  174.2  11.2    2.4e-55  173.9  11.2    1.1  1  VIMSS217052  


Domain annotation for each sequence (and alignments):
>> VIMSS217052  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  173.9  11.2   2.4e-55   2.4e-55       1     212 []     167     375 .]     167     375 .] 0.98

  Alignments for each domain:
  == domain 1  score: 173.9 bits;  conditional E-value: 2.4e-55
       DUF481   1 velGlslktGNtettslnaalklkrrtgrwrlslkaeyeygesngettaekyrvslqydyklserlylfalgsyetDrfsgldsratlgaGlGyrlid 98 
                  v++ l++k+++++t+++++++k++ r+grwr+++++ey++++++++tt++++++++ +d++++++++++++++y++D++++l +++t+g+G+Gy+++d
  VIMSS217052 167 VDVALDYKRAENDTDDYDVGFKTTARHGRWRHNAEGEYNRETKDDVTTTNNWSAEYALDRFITDKWFWQGRAEYKRDHIEDLARQRTVGTGPGYQFWD 264
                  67889********************************************************************************************* PP

       DUF481  99 tdktklsleaGpgyrytkytdeeeeedeeevilrlsldy.eykisdnvsftqdlevevnleggsnttlrsetgltvkltdalslkisyevdydsdppe 195
                  ++  ++sl+  ++ ++ +y+d+    +++++++ +++dy +y i +nv+++++ e+ ++l g ++++l++e+gl++k+t++ sl++++e d  +   e
  VIMSS217052 265 DELGAFSLGSLINRTDFEYRDG---GKDNFYSAAVKWDYtRYLIGKNVQLFTNGEFAKPLGGVADYSLDAEVGLRYKVTEWASLNLKAEKDIITGTRE 359
                  **********************...************************************************************************8 PP

       DUF481 196 gkkktDtrlsvsLvysF 212
                  + + + tr+++++++++
  VIMSS217052 360 S-DLDKTRYTAGFGVTW 375
                  5.9999********998 PP



Or compare VIMSS217052 to CDD or PaperBLAST