PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS337315 to PF04338 (DUF481)

VIMSS337315 has 335 amino acids

Query:       DUF481  [M=212]
Accession:   PF04338.12
Description: Protein of unknown function, DUF481
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.6e-52  164.1  10.7    3.1e-52  163.8  10.7    1.1  1  VIMSS337315  


Domain annotation for each sequence (and alignments):
>> VIMSS337315  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  163.8  10.7   3.1e-52   3.1e-52       1     212 []     127     335 .]     127     335 .] 0.99

  Alignments for each domain:
  == domain 1  score: 163.8 bits;  conditional E-value: 3.1e-52
       DUF481   1 velGlslktGNtettslnaalklkrrtgrwrlslkaeyeygesngettaekyrvslqydyklserlylfalgsyetDrfsgldsratlgaGlGyrlid 98 
                  +++ l++++++++t+++n+a+k++ r+g+wr+++k++y+++++++++ ++++++++ +d++l+e++++ a++ y++D++++l +++++g+G+Gy+l+d
  VIMSS337315 127 IDAALDFQQAENDTNDYNVAFKTSARHGQWRHNAKGDYNRETTDDVVGTDNWSAEYSLDRFLTEKFFWDARVTYKRDKIEDLSRQRVVGTGPGYQLWD 224
                  578999******************************************************************************************** PP

       DUF481  99 tdktklsleaGpgyrytkytdeeeeedeeevilrlsldy.eykisdnvsftqdlevevnleggsnttlrsetgltvkltdalslkisyevdydsdppe 195
                  ++  +++++a ++ ++ +++++   ++e+++++ + +dy +y i ++++f+ + e+ ++l+g ++++++ e+gl++k+td+ sl++++e +  s  ++
  VIMSS337315 225 DELGAFKVGALLNRTDFEFSNG---QKENFYSVAGTWDYnRYLIGKKFEFFSNGELGKPLSGVADYSMDVEAGLRYKVTDWASLNVKAEKNVISGSDN 319
                  **********************...************************************************************************8 PP

       DUF481 196 gkkktDtrlsvsLvysF 212
                  g + + tr+++++++s+
  VIMSS337315 320 G-DVDKTRYTAGFGVSW 335
                  7.99***********98 PP



Or compare VIMSS337315 to CDD or PaperBLAST