PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS562917 to PF04338 (DUF481)

VIMSS562917 has 260 amino acids

Query:       DUF481  [M=212]
Accession:   PF04338.12
Description: Protein of unknown function, DUF481
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.8e-12   33.2   0.3    3.7e-12   32.8   0.3    1.2  1  VIMSS562917  


Domain annotation for each sequence (and alignments):
>> VIMSS562917  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.8   0.3   3.7e-12   3.7e-12      36     193 ..      77     241 ..      52     259 .. 0.83

  Alignments for each domain:
  == domain 1  score: 32.8 bits;  conditional E-value: 3.7e-12
       DUF481  36 aeyeygesngettaekyrvslqydyklserlylfalgsyetDrfsgldsratlgaGlGyrlidtdktklsleaGpgyrytkytdee......eeedee 127
                   ++e+++  +++t +  +v+ +y+y l  ++ ++ +++ ++ + +g++++ ++g+  +yrl+++d++ +++ +G+ ++++k ++        ++   +
  VIMSS562917  77 NKLEFSTYGNKVTVSGGYVHTEYRYLLHHVFEVYPYVESQWAESRGMKYKVSTGLQSRYRLVNSDNCLMFATLGVFFEFEKWEQPAtslfagTYAYSR 174
                  467788888999********************************************************************8877667899999***** PP

       DUF481 128 evilrlsldyeykisdnvsftqdlevevnl.eggsnttlrsetgltvkltdalslkisyevdydsdp 193
                  ++  +ls+++++++ ++ +ft+++  + +  +  ++ ++   + l++ +t  + ++ +y++ yd+ p
  VIMSS562917 175 SIKSHLSISFRHRLGEHWEFTTTAIHQGKPdSYFKKARFGGAIDLKYHITPTIGIRGAYRIIYDTAP 241
                  **********************998887321233444444445566666666777778888887776 PP



Or compare VIMSS562917 to CDD or PaperBLAST