PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS60840 to PF04338 (DUF481)

VIMSS60840 has 335 amino acids

Query:       DUF481  [M=212]
Accession:   PF04338.12
Description: Protein of unknown function, DUF481
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    9.9e-54  168.7  10.3    1.4e-53  168.2  10.3    1.2  1  VIMSS60840  


Domain annotation for each sequence (and alignments):
>> VIMSS60840  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  168.2  10.3   1.4e-53   1.4e-53       1     212 []     128     335 .]     128     335 .] 0.99

  Alignments for each domain:
  == domain 1  score: 168.2 bits;  conditional E-value: 1.4e-53
      DUF481   1 velGlslktGNtettslnaalklkrrtgrwrlslkaeyeygesngettaekyrvslqydyklserlylfalgsyetDrfsgldsratlgaGlGyrlidt 99 
                 v+++l+ k+++++ +++++++k+  r+g wr+++++ey+++++ng++++++y++++ +d+++++++++++++ y++D +++l +++t+g+G+Gy+++d+
  VIMSS60840 128 VDFSLDRKQAENDVSDYDIDFKTNARHGLWRHNVQGEYNREKKNGQVSTDNYSGQYALDRFIDDHWFWQGQVAYKRDMIEDLAKKRTVGTGPGYQFWDN 226
                 79************************************************************************************************* PP

      DUF481 100 dktklsleaGpgyrytkytdeeeeedeeevilrlsldy.eykisdnvsftqdlevevnleggsnttlrsetgltvkltdalslkisyevdydsdppegk 197
                 +  ++s+ + ++ +++++ d+   e+e++++  +++dy +y + ++++++++ ev ++l++g +++l++e+g+++klt++ sl++++e+d  s  +   
  VIMSS60840 227 ELGAFSIATLVNRNDYEFADG---EKEHFYSSSFKWDYnRYLLAKQFELFTNGEVSKPLQSGLDYELQTEAGIRYKLTSWASLSMKAEWDKFSGNDG-- 320
                 *********************...************************************************************************6.. PP

      DUF481 198 kktDtrlsvsLvysF 212
                 + + +r++++L++++
  VIMSS60840 321 NVNQRRYTFGLGVGW 335
                 9************98 PP



Or compare VIMSS60840 to CDD or PaperBLAST