PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS326053 to PF04341 (DUF485)

VIMSS326053 has 106 amino acids

Query:       DUF485  [M=89]
Accession:   PF04341.12
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.6e-30   91.3   4.3    1.8e-30   91.1   4.3    1.0  1  VIMSS326053  


Domain annotation for each sequence (and alignments):
>> VIMSS326053  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   91.1   4.3   1.8e-30   1.8e-30       2      88 ..      15     101 ..      14     102 .. 0.98

  Alignments for each domain:
  == domain 1  score: 91.1 bits;  conditional E-value: 1.8e-30
       DUF485   2 aspkFqeLvrkrrrfafpltaiflvvYfgfvllvafapdllatkvgegnitvglllgllqivltflltglYvrrAnrefDplaeeir 88 
                  a++k+++L+r+r+ ++++lt+++lvvYfgf+ l+af++++la ++++g++t g++++++++++++++t++Yv ++n  +D+l+++i+
  VIMSS326053  15 ANRKYHALKRQRNVLSWLLTLLMLVVYFGFIGLIAFNKAFLAVPLASGVTTRGIPIAIGVMLFAIIVTAVYVFFSNIVYDKLSRNIL 101
                  689*********************************************************************************998 PP



Or compare VIMSS326053 to CDD or PaperBLAST