PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS382658 to PF04341 (DUF485)

VIMSS382658 has 102 amino acids

Query:       DUF485  [M=89]
Accession:   PF04341.12
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.4e-30   91.5   1.0    1.6e-30   91.3   1.0    1.1  1  VIMSS382658  


Domain annotation for each sequence (and alignments):
>> VIMSS382658  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   91.3   1.0   1.6e-30   1.6e-30       2      88 ..      13      98 ..      12      99 .. 0.98

  Alignments for each domain:
  == domain 1  score: 91.3 bits;  conditional E-value: 1.6e-30
       DUF485  2 aspkFqeLvrkrrrfafpltaiflvvYfgfvllvafapdllatkvgegnitvglllgllqivltflltglYvrrAnrefDplaeeir 88
                 ++pkF eL+rk+++f + ++++  v+Yf++++ +a+ap+l++ k++ g i++g+l++l+q+++++ ++++Y+++An++fD+l++e++
  VIMSS382658 13 RNPKFVELHRKKTTFLVGWWVFSTVFYFLLPIGAAYAPGLFKIKIL-GRINIGYLFALSQFFVSWGIAMYYAHVANKDFDRLTRELV 98
                 79********************************************.*************************************997 PP



Or compare VIMSS382658 to CDD or PaperBLAST