VIMSS382658 has 102 amino acids
Query: DUF485 [M=89]
Accession: PF04341.16
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-31 93.9 0.9 2.8e-31 93.7 0.9 1.1 1 VIMSS382658
Domain annotation for each sequence (and alignments):
>> VIMSS382658
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 93.7 0.9 2.8e-31 2.8e-31 2 88 .. 13 98 .. 12 99 .. 0.98
Alignments for each domain:
== domain 1 score: 93.7 bits; conditional E-value: 2.8e-31
DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDplaeeir 88
++pkF eL+rk+++f++ ++++ v+Yfl+++ +a+ap+l+++k+ g i++g+l++l+qf++++ ++++Y+++An++fD+l++e++
VIMSS382658 13 RNPKFVELHRKKTTFLVGWWVFSTVFYFLLPIGAAYAPGLFKIKIL-GRINIGYLFALSQFFVSWGIAMYYAHVANKDFDRLTRELV 98
79********************************************.*************************************997 PP
Or compare VIMSS382658 to CDD or PaperBLAST