PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::azobra:AZOBR_RS02935 to PF04341 (DUF485)

reanno::azobra:AZOBR_RS02935 has 100 amino acids

Query:       DUF485  [M=89]
Accession:   PF04341.12
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                     -----------
    1.3e-41  126.8   0.2    1.4e-41  126.7   0.2    1.0  1  reanno::azobra:AZOBR_RS02935  


Domain annotation for each sequence (and alignments):
>> reanno::azobra:AZOBR_RS02935  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  126.7   0.2   1.4e-41   1.4e-41       2      88 ..      10      96 ..       9      97 .. 0.98

  Alignments for each domain:
  == domain 1  score: 126.7 bits;  conditional E-value: 1.4e-41
                        DUF485  2 aspkFqeLvrkrrrfafpltaiflvvYfgfvllvafapdllatkvgegnitvglllgllqivltflltglYvrrAnrefDpla 84
                                  a+pkFqeLv+kr++fa++l++++lv+Yfgf+llvaf +++l+t++g+g++t+g+++gl+ i+++f+ltg+Yv+rAn+efD+l+
  reanno::azobra:AZOBR_RS02935 10 ANPKFQELVQKRSAFAWTLSIAMLVIYFGFILLVAFGKGFLGTPIGSGVTTWGIPVGLFTIISAFILTGIYVHRANGEFDELN 92
                                  69********************************************************************************* PP

                        DUF485 85 eeir 88
                                  ++i+
  reanno::azobra:AZOBR_RS02935 93 RQIM 96
                                  **97 PP



Or compare reanno::azobra:AZOBR_RS02935 to CDD or PaperBLAST