VIMSS5923013 has 102 amino acids
Query: DUF493 [M=84]
Accession: PF04359.18
Description: Protein of unknown function (DUF493)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-36 111.3 0.0 1.7e-36 111.0 0.0 1.1 1 VIMSS5923013
Domain annotation for each sequence (and alignments):
>> VIMSS5923013
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 111.0 0.0 1.7e-36 1.7e-36 1 84 [] 19 102 .] 19 102 .] 0.98
Alignments for each domain:
== domain 1 score: 111.0 bits; conditional E-value: 1.7e-36
DUF493 1 eelleFPcdfpikviGkaeeefeeavvevverhapefdpeevevrpSskgkYvSvtvtvtveskeqldaiyraLkahervkmvL 84
e+lleFPcdfpik++Gka++ef++++++vv+ h +e+d e++e r+Ss+g+Y+ +t+tv+++s+eqld+iyraL+ h++vk+vL
VIMSS5923013 19 ESLLEFPCDFPIKIMGKAHPEFKDTIFKVVAVHDNEIDVEKIEERASSGGNYTGLTITVRATSQEQLDNIYRALTGHPMVKVVL 102
579*******************************************************************************98 PP
Or compare VIMSS5923013 to CDD or PaperBLAST