F6SQH7 has 284 amino acids
Query: DUF525 [M=87]
Accession: PF04379.18
Description: ApaG domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-17 50.4 0.0 2.3e-17 49.4 0.0 1.4 1 F6SQH7
Domain annotation for each sequence (and alignments):
>> F6SQH7
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 49.4 0.0 2.3e-17 2.3e-17 4 60 .. 220 276 .. 218 278 .. 0.94
Alignments for each domain:
== domain 1 score: 49.4 bits; conditional E-value: 2.3e-17
DUF525 4 sspeeeryvFaYtirienegeesvqLlsrhwiitdangkveevegegVvgeqPvLkp 60
++++++ y+++Y ir+en ++ vqL++rhw+i + +g+ e+v+g+gVvg+ +L p
F6SQH7 220 EAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRGVVGRVSILGP 276
5678999*******************************************9998866 PP
Or compare F6SQH7 to CDD or PaperBLAST