VIMSS57042 has 126 amino acids
Query: DUF525 [M=87] Accession: PF04379.18 Description: ApaG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-42 129.8 0.0 2.2e-42 129.5 0.0 1.1 1 VIMSS57042 Domain annotation for each sequence (and alignments): >> VIMSS57042 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 129.5 0.0 2.2e-42 2.2e-42 1 85 [. 18 102 .. 18 104 .. 0.98 Alignments for each domain: == domain 1 score: 129.5 bits; conditional E-value: 2.2e-42 DUF525 1 eeqsspeeeryvFaYtirienegeesvqLlsrhwiitdangkveevegegVvgeqPvLkpgesfeYtsgvsletpsGsmeGsytm 85 +eqs+pe++r++FaYt++ien+ge ++qLlsrhwiitd++g+++ev+g gVvgeqP+++pg++++Ytsg++l+t++Gsm+Gsy+m VIMSS57042 18 PEQSAPEQNRFAFAYTVTIENQGEVPAQLLSRHWIITDGDGRTQEVRGAGVVGEQPLIAPGAQHTYTSGTVLATRVGSMRGSYQM 102 589*********************************************************************************9 PP
Or compare VIMSS57042 to CDD or PaperBLAST