VIMSS91524 has 125 amino acids
Query: DUF525 [M=87] Accession: PF04379.18 Description: ApaG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-40 121.3 0.0 9.7e-40 121.1 0.0 1.1 1 VIMSS91524 Domain annotation for each sequence (and alignments): >> VIMSS91524 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 121.1 0.0 9.7e-40 9.7e-40 2 86 .. 18 102 .. 17 103 .. 0.98 Alignments for each domain: == domain 1 score: 121.1 bits; conditional E-value: 9.7e-40 DUF525 2 eqsspeeeryvFaYtirienegeesvqLlsrhwiitdangkveevegegVvgeqPvLkpgesfeYtsgvsletpsGsmeGsytmv 86 qssp++eryvFaYt++i+n g+ +vqLl r+w it++ng+++ev+gegVvg qP+++pge+++Ytsg+ +etp G+m+G+y+m VIMSS91524 18 AQSSPDNERYVFAYTVTIRNLGRAPVQLLGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMI 102 79*********************************************************************************97 PP
Or compare VIMSS91524 to CDD or PaperBLAST