PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS148298 to PF04393 (DUF535)

VIMSS148298 has 322 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   6.8e-102  326.5   2.7   7.8e-102  326.3   2.7    1.0  1  VIMSS148298  


Domain annotation for each sequence (and alignments):
>> VIMSS148298  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  326.3   2.7  7.8e-102  7.8e-102       2     279 ..      40     316 ..      39     318 .. 0.99

  Alignments for each domain:
  == domain 1  score: 326.3 bits;  conditional E-value: 7.8e-102
       DUF535   2 kwkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaele 99 
                  +w+++++r kfl+rsl++pr+t++ll++l+q+p+l++ll++qprl+ +l+rpY++ n+++   l+a++ hy+ +++ll++e+   +l++ gl+la++e
  VIMSS148298  40 FWRKASFRRKFLIRSLVMPRATSQLLTNLTQWPELNTLLARQPRLPIRLHRPYMAVNIKRDFALDALCFHYQQMRQLLSREQQVSYLSQYGLNLAKFE 137
                  7************************************************************************************************* PP

       DUF535 100 gkeeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllaealgve 197
                  +k +e ++l+L +  +++kEGe ++++rd++ ++l+++tFtl++ ++++tl+IG+lQG+ ++ ++e+i+q+TKachGl+Pkr+++eal+++a+++++e
  VIMSS148298 138 TKTGELFQLDLVSLVSLDKEGESTIVVRDAQLRILAEITFTLCRFNQQRTLFIGGLQGAANDVPHEIIQQATKACHGLFPKRIVMEALCQFAQVFQAE 235
                  ************************************************************************************************** PP

       DUF535 198 qilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqi 279
                  +i+avsn++hvyr++ry ++kk++++adYd+fWe+lgGe+ + +yy+LPl+++rk+ +eiaskKR+eYr+Ryalld++ eq+
  VIMSS148298 236 KIIAVSNDAHVYRSWRY-MDKKTQMHADYDAFWESLGGERIKGNYYTLPLAIARKSEAEIASKKRAEYRRRYALLDSVVEQV 316
                  *****************.5**********************************************************99987 PP



Or compare VIMSS148298 to CDD or PaperBLAST