PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS150088 to PF04393 (DUF535)

VIMSS150088 has 309 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.3e-95  305.9   0.2    1.5e-95  305.7   0.2    1.0  1  VIMSS150088  


Domain annotation for each sequence (and alignments):
>> VIMSS150088  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  305.7   0.2   1.5e-95   1.5e-95       2     280 ..      30     305 ..      29     306 .. 0.98

  Alignments for each domain:
  == domain 1  score: 305.7 bits;  conditional E-value: 1.5e-95
       DUF535   2 kwkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaele 99 
                   w e+++r+kfllr+l++p +t k+ ++l + ++ ++l+ ++p l+ k++rpYl+ +ls + r++ai +hy+f+++  ++++ + ll+++++ la+le
  VIMSS150088  30 RWGERKFRYKFLLRCLINPVTTIKYFNELCHLSQPRTLIIHRPLLPAKIQRPYLYTGLSIRCRAKAILEHYQFVQSFPESKIKKILLSEEQILLAHLE 127
                  699*********************************************************************************************** PP

       DUF535 100 gkeeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllaealgve 197
                  gk+++ +++++    g+++EGel+L+l+++d ++l++l+F+++++eg++  l+++lQGp+k+ + ++i+++TK+c+Gl+Pkr+l ea+ +l++a++v+
  VIMSS150088 128 GKNGALVDIYC-GPCGYDREGELTLTLCFND-TPLARLSFSFIRHEGKQIALVAGLQGPSKHIGPQVIRNATKDCYGLFPKRMLYEAFATLMQACNVD 223
                  ***********.6****************77.99**************************************************************** PP

       DUF535 198 qilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqia 280
                  +i+avs+++hvyrqlry ++kkk++va+Y+efWe+l+G  k+  +y+LP ++ rk++e+i+skKR+eYrkRy++ld++ ++++
  VIMSS150088 224 EIYAVSENNHVYRQLRYLFQKKKTFVASYSEFWESLNGV-KKGALYHLPSQVMRKAPESIPSKKRAEYRKRYHILDTIIQEVN 305
                  **************************************6.5666**********************************99986 PP



Or compare VIMSS150088 to CDD or PaperBLAST