PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1727278 to PF04393 (DUF535)

VIMSS1727278 has 316 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.3e-89  284.9   0.0    3.8e-89  284.7   0.0    1.0  1  VIMSS1727278  


Domain annotation for each sequence (and alignments):
>> VIMSS1727278  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  284.7   0.0   3.8e-89   3.8e-89       2     278 ..      26     298 ..      25     301 .. 0.97

  Alignments for each domain:
  == domain 1  score: 284.7 bits;  conditional E-value: 3.8e-89
        DUF535   2 kwkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlael 98 
                   kw+++++r+ ++lr+ ++p    +++ +l++ p+++++l+ +p+l+ +++rpYl+k+  a+ r + i +hy+f+++l + +  + l+ +k+++l+++
  VIMSS1727278  26 KWEHRKFRFMYILRCSINPVVSIRYYYELRSLPCIEDILAIHPTLPARIHRPYLHKGGRAWTRGQYILEHYRFVQNLPE-KYSKFLFPQKSVSLVQF 121
                   79***********************************************************************998855.8889999999******* PP

        DUF535  99 egkeeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllaealg 195
                    gk++e++++++ + +g+++EGel L+l++++ +++++ltF+++ +++++  +IG+lQG+ k+++ ++i+ +T+ac+G++Pkr+++ea+++l++a++
  VIMSS1727278 122 IGKDGENFDIQC-SPSGFDREGELMLSLFYNK-TVIARLTFSVILTQNGHIAFIGGLQGAPKNTGPDVIRCATRACYGIFPKRIIFEAFCALMKACN 216
                   ************.6****************66.77************************************************************** PP

        DUF535 196 veqilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeq 278
                   ++++lavs+++hv+rqlry+++k+k +va Y++fWe++ G+ ++ ++y+LP+++ rk+l++iaskKRseYrkRyalld ++e+
  VIMSS1727278 217 ISECLAVSEHSHVFRQLRYWYQKRKIFVAVYSDFWESVAGK-TCGDWYRLPTQVIRKPLSDIASKKRSEYRKRYALLDYIHET 298
                   ****************************************6.5666*********************************9886 PP



Or compare VIMSS1727278 to CDD or PaperBLAST