PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS218818 to PF04393 (DUF535)

VIMSS218818 has 333 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.4e-75  240.3   0.0    1.6e-75  240.0   0.0    1.0  1  VIMSS218818  


Domain annotation for each sequence (and alignments):
>> VIMSS218818  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  240.0   0.0   1.6e-75   1.6e-75       3     280 ..      18     296 ..      16     297 .. 0.94

  Alignments for each domain:
  == domain 1  score: 240.0 bits;  conditional E-value: 1.6e-75
       DUF535   3 wkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaeleg 100
                  ++ +++++k++ + ++++++++ ++q+++++   + l +   +++  +++pY+s++++a qrle++ +h++ +  +++a l   l ++++l+l++l++
  VIMSS218818  18 LRAMHNKYKLARQIARQWPELNGFMQRMTAALGPHGLQRLGVDCIGVVQWPYISRCWEAPQRLEVVATHFERVAGQFPALL--LLGRDENLRLCDLSS 113
                  67899*************************************************************************776..5566679*****998 PP

       DUF535 101 keeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenake....likqlTKachGlrPkrLllealkllaeal 194
                  ++ + ++l L+   ++++EGel L+l+++d  +++sl+Ftl +++ge++l+IGa+QG +k  ++e    ++++lTK+++GlrP++Lllealk+l ++l
  VIMSS218818 114 HSPG-CCLVLDRPIWFKREGELVLNLFQAD-LRVASLAFTLGRSQGETCLFIGAVQGIHKGIDSEtslaIYRDLTKDFEGLRPRSLLLEALKCLGRTL 209
                  8777.***********************99.66************************9999887767779**************************** PP

       DUF535 195 gveqilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdk.eyyeLPleeerkdleeiaskKRseYrkRyalldeleeqia 280
                  gv+q++avs++++++r+  +  +k ++l a+Yd +W+e+g++a+d+ ++++LPl++++++ ++i+ kKR++Yr+R+alld++ ++++
  VIMSS218818 210 GVTQLYAVSDACRHHRHPYFGSDKGQDLAANYDVIWQEHGATASDReDFFSLPLAPAQRAETDIPAKKRAMYRRRQALLDDVFTRLQ 296
                  *****************************************9966515677*******************************99876 PP



Or compare VIMSS218818 to CDD or PaperBLAST