PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS273338 to PF04393 (DUF535)

VIMSS273338 has 315 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   2.5e-104  334.5   0.8   2.9e-104  334.3   0.8    1.0  1  VIMSS273338  


Domain annotation for each sequence (and alignments):
>> VIMSS273338  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  334.3   0.8  2.9e-104  2.9e-104       2     279 ..      33     310 ..      32     312 .. 0.99

  Alignments for each domain:
  == domain 1  score: 334.3 bits;  conditional E-value: 2.9e-104
       DUF535   2 kwkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaele 99 
                  +w+e+++rlkf++r+l+ pr t ++l  l+++p l++ll++qp+l++kl+rpYls++++ +q+l++++dh+++++++++++l  ++l++++++l++l+
  VIMSS273338  33 SWQEWKFRLKFIIRALISPRLTFNFLILLSKQPFLHSLLRAQPDLPCKLHRPYLSHTFNNRQKLDVLRDHFQLITQCMPKALHYNYLHRTPYRLVTLT 130
                  7************************************************************************************************* PP

       DUF535 100 gkeeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllaealgve 197
                  gk +e+++l+L i ++++kEGe++L+l +e++q+l+ ltF+l+ ++++ktl+IG+lQG+ ++++++ i+++TKachGl+PkrL lea++ lae +g+e
  VIMSS273338 131 GKGGEKYSLYLGIIPKLNKEGEITLMLANEQQQTLALLTFSLFYYQQQKTLFIGGLQGADNKTPHHEIQACTKACHGLFPKRLALEATCYLAELMGIE 228
                  ************************************************************************************************** PP

       DUF535 198 qilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqi 279
                  +i+av n++h+y+++ryr kkk+kl+adYd fW +lgG+++++++++LP+++ rk+l+eiaskKR+eYr+Ry ll++le+ +
  VIMSS273338 229 EIIAVGNATHIYQNWRYRAKKKNKLHADYDGFWLSLGGNPDTEGHFRLPTKIVRKPLTEIASKKRAEYRRRYVLLEQLEAGL 310
                  ******************************************************************************9876 PP



Or compare VIMSS273338 to CDD or PaperBLAST