PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS302824 to PF04393 (DUF535)

VIMSS302824 has 330 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
     1e-103  332.5   1.8   1.2e-103  332.3   1.8    1.0  1  VIMSS302824  


Domain annotation for each sequence (and alignments):
>> VIMSS302824  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  332.3   1.8  1.2e-103  1.2e-103       2     280 ..      48     325 ..      47     326 .. 0.99

  Alignments for each domain:
  == domain 1  score: 332.3 bits;  conditional E-value: 1.2e-103
       DUF535   2 kwkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaele 99 
                  +w+++++r kfllrsl++pr   +++++l+++p+l+ ll++qprl+ +l+rpYl++nls+kq lea+++hy++l+ +++ae ++ +l++ gl+la+le
  VIMSS302824  48 FWHRRSFRQKFLLRSLIMPRLSVEWMNELSHWPNLNVLLTRQPRLPVRLHRPYLAANLSRKQLLEALRYHYALLRGCMSAEEFSLYLNTPGLQLAKLE 145
                  79************************************************************************************************ PP

       DUF535 100 gkeeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllaealgve 197
                  gk++e+++leL+++ + +kEG  ++ +r++++ +l++ltFtl++++g++t++IG+lQG+k e +++ i+++TKachGl+PkrL++ea++l+a++l+ve
  VIMSS302824 146 GKNGEQFTLELTMMISMDKEGDSTILFRNSEGIPLAELTFTLCEYQGKRTMFIGGLQGAKWEIPHQEIQNATKACHGLFPKRLVMEAACLFAQRLQVE 243
                  ************************************************************************************************** PP

       DUF535 198 qilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqia 280
                  qi+avsn++h+yr+lryr +k+ k++adY++fWe++gG ++++++y+LP +++rk+++eiaskKR+eYr+Ry++ld ++ q+a
  VIMSS302824 244 QIIAVSNETHIYRSLRYR-DKEGKIHADYNAFWESVGGVCDAERHYRLPAQIARKEIAEIASKKRAEYRRRYEMLDAIQPQMA 325
                  *****************7.************************************************************9997 PP



Or compare VIMSS302824 to CDD or PaperBLAST