PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3382795 to PF04393 (DUF535)

VIMSS3382795 has 322 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
   4.5e-103  330.4   1.2   5.1e-103  330.2   1.2    1.0  1  VIMSS3382795  


Domain annotation for each sequence (and alignments):
>> VIMSS3382795  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  330.2   1.2  5.1e-103  5.1e-103       3     280 ..      36     313 ..      34     314 .. 0.99

  Alignments for each domain:
  == domain 1  score: 330.2 bits;  conditional E-value: 5.1e-103
        DUF535   3 wkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaele 99 
                   w+++++r+kfllr++l++++t+++l++l++ + +++ll++q +l+ k++r+Yl ++l+a+qr+ a+++hy+++++l +++l +++ + +++ l++l+
  VIMSS3382795  36 WRQKNYRFKFLLRTALFYNATRAMLEALSARDDFNQLLAAQATLPGKVHRQYLTRDLNAWQRAVAVINHYRYIDTLRGSRLAHAMTAVSEVPLLTLN 132
                   9************************************************************************************************ PP

        DUF535 100 gkeeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllaealgv 196
                   gke+ +++l+ s+  + ++EGe++L+lrd+d++ll+s+tF++++++  ++l+IG+lQGp+++ ++e+ikq+T+ac+Gl+PkrLlle +++la++ ++
  VIMSS3382795 133 GKEDRRFTLYASSAGKAEREGETTLWLRDSDHTLLASATFSVTRDHDAWQLVIGGLQGPRRHVSHEVIKQATRACYGLFPKRLLLEFIWQLAARSQI 229
                   ************************************************************************************************* PP

        DUF535 197 eqilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqia 280
                    +i++vs++ghv+r+lryrl+k ++++a+YdefW++++G++++++ ++LPl+ erk+le+iaskKR+eYr+R++lld+l+eq+a
  VIMSS3382795 230 AAIYGVSDNGHVFRALRYRLSKGRHFHASYDEFWQSIDGQPESPWRWRLPLCLERKSLESIASKKRAEYRRRFQLLDQLTEQVA 313
                   *********************************************************************************985 PP



Or compare VIMSS3382795 to CDD or PaperBLAST