PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3624513 to PF04393 (DUF535)

VIMSS3624513 has 318 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
   2.1e-100  321.6   0.1   2.4e-100  321.4   0.1    1.0  1  VIMSS3624513  


Domain annotation for each sequence (and alignments):
>> VIMSS3624513  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  321.4   0.1  2.4e-100  2.4e-100       3     280 ..      36     313 ..      34     314 .. 0.99

  Alignments for each domain:
  == domain 1  score: 321.4 bits;  conditional E-value: 2.4e-100
        DUF535   3 wkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaele 99 
                   w++ ++r kf+lrsl++p +t++ll  l+++p l ++++ qp l+++l+rp+ls n+++++ l+a+  hy++++++l+a+l++ +l+k+g+tl++l+
  VIMSS3624513  36 WQNPSYRRKFMLRSLATPFSTTRLLASLAKQPRLMQMMQVQPGLPCRLHRPWLSVNMNRQKTLDALAWHYQTMNSVLPAALMNGYLSKQGVTLLTLT 132
                   9999********************************************************************************************* PP

        DUF535 100 gkeeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllaealgv 196
                   gk+e++++++L+++a ++kEGe +L ++d+++++l+++tFtl++ eg+ tl+IG++QG+k   ++eli+ +TKachGl+PkrLl+ea+++l +a+ v
  VIMSS3624513 133 GKDEQQFTIRLCADAFLDKEGEATLAFCDRENTVLAEMTFTLCQFEGKSTLFIGGMQGAKAFVPHELIQGATKACHGLFPKRLLVEAAMTLGAAFPV 229
                   ************************************************************************************************* PP

        DUF535 197 eqilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqia 280
                   eqilavsn++h+yr++ryr+kk+ kl+adYd+fW+++gGe+++ + ++L l+++rk++e+iaskKRseYr+Ry+lld+l  q++
  VIMSS3624513 230 EQILAVSNATHIYRSWRYRKKKEGKLLADYDSFWRSIGGEQHSTGNFSLSLAMPRKPMEDIASKKRSEYRRRYELLDSLIDQVN 313
                   *******************************************************************************99987 PP



Or compare VIMSS3624513 to CDD or PaperBLAST