PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3625536 to PF04393 (DUF535)

VIMSS3625536 has 313 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.3e-94  302.7   0.0    1.5e-94  302.5   0.0    1.0  1  VIMSS3625536  


Domain annotation for each sequence (and alignments):
>> VIMSS3625536  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  302.5   0.0   1.5e-94   1.5e-94       3     280 ..      33     310 ..      31     311 .. 0.99

  Alignments for each domain:
  == domain 1  score: 302.5 bits;  conditional E-value: 1.5e-94
        DUF535   3 wkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaele 99 
                   w+++ +rlkf+lrsll++++t+++l++l++   +++ll++q +l++k +r+Yl +++ akqr+ea+++hy++l+ l  a+l ++l ++ +   ++++
  VIMSS3625536  33 WRKRDYRLKFFLRSLLFWSSTNHMLTALSRRADFDKLLAAQITLPSKTHRQYLTRGIGAKQRAEAVIHHYEWLDALPDANLKNALTHQIAQPVVHFQ 129
                   9****************************************************************************999999999999******** PP

        DUF535 100 gkeeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllaealgv 196
                    k++  +++  s  ++ ++EGe +L+lrd++++ll+sltF+++ +    +l+IG+lQGp++  ++++ik++T+achGl+Pkr l+e++  l+++ ++
  VIMSS3625536 130 AKDDVGYTVFASTASKAEREGESTLWLRDNEDTLLASLTFSVVPEGDHSALVIGGLQGPRRGVTRDAIKKATRACHGLFPKRVLMEVIFNLVAQSDI 226
                   *******************************************999*************************************************** PP

        DUF535 197 eqilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqia 280
                   ++i++vs++ghv+r+lryrl+k ++++a+YdefW++++G++ ++  ++LPl++erk+le+iaskKR+eYr+R+ llde++e+++
  VIMSS3625536 227 KAIYGVSDEGHVFRALRYRLSKGRHFHASYDEFWASIDGNKISSFRWALPLAMERKSLESIASKKRAEYRRRFGLLDEIAESVK 310
                   ********************************************************************************9987 PP



Or compare VIMSS3625536 to CDD or PaperBLAST