PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS4329957 to PF04393 (DUF535)

VIMSS4329957 has 291 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.3e-93  297.7   7.8    4.9e-93  297.5   7.8    1.0  1  VIMSS4329957  


Domain annotation for each sequence (and alignments):
>> VIMSS4329957  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  297.5   7.8   4.9e-93   4.9e-93       3     281 .]      25     290 ..      23     290 .. 0.98

  Alignments for each domain:
  == domain 1  score: 297.5 bits;  conditional E-value: 4.9e-93
        DUF535   3 wkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaele 99 
                   +k++r++l+++ +++l+++q+++l++fln+++++++l+++  ++++++l+++++k++sa++rl+ai+ +++++ee+++++l+q+ll+++++ l++  
  VIMSS4329957  25 LKQVREKLRYYGYKWLYQKQCHQLVDFLNTETQWQSLFTQDYYRINTILTTFCDKRFSASERLTAITANLRLAEEKMGRSLCQQLLDQQHIVLTQ-- 119
                   6899******************************************************************************************9.. PP

        DUF535 100 gkeeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllaealgv 196
                      +e+l+l+Lsin+ ++ EG++s+++r+++++++y+++Ft+l   + ++llI+++QGp++ na+el+kq+TKa+hG+rP+++l++ +k+lae++++
  VIMSS4329957 120 --LTEDLRLSLSINHIDPFEGYFSINIRNQNNERVYDASFTFL---SPNKLLIASIQGPSSGNAQELVKQATKALHGMRPMFMLVNGFKMLAEKWQC 211
                   ..99***************************************...889************************************************ PP

        DUF535 197 eqilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqiae 281
                    +++++++k     q +yrl+ ++k++++YdefW+e++Ge + ++y++LPl++erk+leeiaskKRs+YrkRy++ld+++  i++
  VIMSS4329957 212 -ELVGIPHK----AQGKYRLSARSKILFNYDEFWQENQGEYR-HNYWQLPLDIERKQLEEIASKKRSMYRKRYEMLDQMALDIQQ 290
                   .********....799***********************855.55**********************************999985 PP



Or compare VIMSS4329957 to CDD or PaperBLAST