PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS53917 to PF04393 (DUF535)

VIMSS53917 has 306 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    7.7e-85  270.6   0.1    8.7e-85  270.4   0.1    1.0  1  VIMSS53917  


Domain annotation for each sequence (and alignments):
>> VIMSS53917  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  270.4   0.1   8.7e-85   8.7e-85       3     280 ..      25     294 ..      23     295 .. 0.96

  Alignments for each domain:
  == domain 1  score: 270.4 bits;  conditional E-value: 8.7e-85
      DUF535   3 wkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaelegk 101
                  k+lr++++f+l+ +l+p +++++++ l ++p ++++ +++pr lek+l+pY++ ++  ++r++ +++h++fle++ + +ll+ +++++g++l++    
  VIMSS53917  25 VKKLRYNARFCLWGILMPDTLARIQDLL-NQPSFHPVRQHYPRTLEKPLKPYVCVKWPPQERAQRLIEHFAFLEKRHA-QLLPLIYRHQGWSLFQ---- 117
                 6899************************.99*******************************************9977.788************6.... PP

      DUF535 102 eeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQG..pkkenakelikqlTKachGlrPkrLllealkllaealgveq 198
                  +e ++++L+  +g ++EG+l+L+l ++d+q+l++l+F++  r+ ++ + IGalQG  p+ en +e+i+qlT+++hGlrPk+L++e+l +la+ + ve+
  VIMSS53917 118 -HELFSIQLC--HGPEREGSLALVLLSQDHQPLFTLAFNISGRN-KPVIHIGALQGpgPNVENRQEIIRQLTHQLHGLRPKALIMEVLLILARYWCVEK 212
                 .888*****9..9**************************99555.**********955566777*********************************** PP

      DUF535 199 ilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqia 280
                 +++v+n+ghvy++lry+ +k++++ ++Y+e+W+e+gGea ++++++LP++++rk++ +++++KR+ Y kRya+l ele++i+
  VIMSS53917 213 VYGVTNEGHVYQALRYIGSKRSSVRFQYSELWQEMGGEAINPYWHSLPTHPPRKAPLSLSKTKRRLYTKRYAWLTELEQSIQ 294
                 ******************************************9999**********************************98 PP



Or compare VIMSS53917 to CDD or PaperBLAST