PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5789877 to PF04393 (DUF535)

VIMSS5789877 has 290 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.5e-88  282.0   6.0    2.8e-88  281.9   6.0    1.0  1  VIMSS5789877  


Domain annotation for each sequence (and alignments):
>> VIMSS5789877  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  281.9   6.0   2.8e-88   2.8e-88       4     280 ..      22     286 ..      19     287 .. 0.98

  Alignments for each domain:
  == domain 1  score: 281.9 bits;  conditional E-value: 2.8e-88
        DUF535   4 kelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaeleg 100
                   k lr+++++ +r++++  q+ +l+++ln+spl++el++++ +++++ll +Y++k+++ kqrl+ai++++t +e+l+  +++++l++++++++a+   
  VIMSS5789877  22 KLLREYFRYSFRKVWCSTQCIQLTNYLNNSPLWAELFNQNLYRVNTLLDTYCDKTFNKKQRLKAIKENFTRFENLFRIHFCNQLVTQQEVCIAK--- 115
                   56799****************************************************************************************8... PP

        DUF535 101 keeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllaealgve 197
                     ++el+l+Lsin+ ++ EG++sL++++++k+++y+++Ftll   +e+++lI+++QGp++++a++lik++TK+++G+rP+++l++++kl+ae++++ 
  VIMSS5789877 116 -LSDELNLYLSINQIDPLEGFFSLNIKNNQKEHIYDASFTLL---EENKILISSIQGPNSKSAQDLIKSATKQLYGIRPMFMLIYIFKLIAEKFNL- 207
                   .8899*************************************...99*************************************************. PP

        DUF535 198 qilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqia 280
                   ++l++++k    rq++yr++++++l+++Yd fW+++++  ++++y++L  ++erk+l+ i+skKRs+Y+kRy+lld+++e+i+
  VIMSS5789877 208 ELLGIPHK----RQAKYRWNDHSRLLFNYDIFWKDNNAILTKNDYWSLSNNIERKPLNIIPSKKRSMYKKRYQLLDDIKEKIN 286
                   ********....9******************************************************************9985 PP



Or compare VIMSS5789877 to CDD or PaperBLAST