PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6811 to PF04393 (DUF535)

VIMSS6811 has 291 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    1.5e-93  299.2   8.0    1.6e-93  299.0   8.0    1.0  1  VIMSS6811  


Domain annotation for each sequence (and alignments):
>> VIMSS6811  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  299.0   8.0   1.6e-93   1.6e-93       3     281 .]      25     290 ..      23     290 .. 0.98

  Alignments for each domain:
  == domain 1  score: 299.0 bits;  conditional E-value: 1.6e-93
     DUF535   3 wkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaelegke 102
                +k++r++l+++ +++l+++q+++l++fln+++++++l+++  ++ +++l+++++k++sa++rl+ai+++++++ee+++++l+q+ll+++++ l++     
  VIMSS6811  25 LKQVREKLRYYGYKWLYQKQCSQLVDFLNTETQWQSLFTQDYYRTNTILTTFCDKRFSASERLTAITENLRLAEEKMGRSLCQQLLDQQHIVLTQ----L 120
                6899******************************************************************************************9....9 PP

     DUF535 103 eeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllaealgveqilav 202
                +e+l+l+Lsin+ ++ EG++s+++r+++++++y+ +Ft+l   + ++llI+++QGp+++na+el+kq+TKa+hG+rP+++l++ +k+lae++++ +++++
  VIMSS6811 121 TEDLRLSLSINHIDPFEGYFSINIRNQNNERVYDSSFTFL---SPNKLLIASIQGPSSDNAQELVKQATKALHGMRPMFMLVNGFKMLAEKWQC-ELVGI 216
                9***************************************...889************************************************.***** PP

     DUF535 203 snkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqiae 281
                ++k     q +yrl+ ++k++++YdefW+e++Ge + ++y++LPl++erk+le+iaskKRs+YrkRy++ld+++  i++
  VIMSS6811 217 PHK----AQGKYRLSARSKILFNYDEFWQENQGEYR-HNYWQLPLHIERKQLEDIASKKRSMYRKRYEMLDQMALDIQQ 290
                ***....799***********************855.55**********************************999985 PP



Or compare VIMSS6811 to CDD or PaperBLAST