PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS858671 to PF04393 (DUF535)

VIMSS858671 has 291 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.8e-94  300.5   9.1    6.6e-94  300.3   9.1    1.0  1  VIMSS858671  


Domain annotation for each sequence (and alignments):
>> VIMSS858671  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  300.3   9.1   6.6e-94   6.6e-94       3     281 .]      25     290 ..      23     290 .. 0.98

  Alignments for each domain:
  == domain 1  score: 300.3 bits;  conditional E-value: 6.6e-94
       DUF535   3 wkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlaeleg 100
                  +k++r++l+++ +++l+++q+++l++fln+++++++l+++  ++ +++l+++++k++sa++rl+ai+++++++ee+++++l+q+ll+++++ l++   
  VIMSS858671  25 LKQVREKLRYYGYKWLYQKQCHQLVDFLNTETQWQSLFTQDYYRTNTILTTFCDKRFSASERLTAITENLRLAEEKMGRSLCQQLLDQQHIVLTQ--- 119
                  6899******************************************************************************************9... PP

       DUF535 101 keeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllaealgveq 198
                    +e+l+l+Lsin+ ++ EG++s+++r+++++++y+++Ft+l   + ++llI+++QGp+++na+el+kq+TKa+hG+rP+++l++a+k+lae++++ +
  VIMSS858671 120 -LTEDLRLSLSINHIDPFEGYFSINIRNQNNERVYDASFTFL---SPNKLLIASIQGPSSDNAQELVKQATKALHGMRPMFMLVNAFKMLAEKWQC-E 212
                  .99***************************************...889************************************************.* PP

       DUF535 199 ilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqiae 281
                  ++++++k     q +yrl+ ++k++++YdefW+e++Ge + ++y++LPl++erk+le+iaskKRs+YrkRy++ld+++  i++
  VIMSS858671 213 LVGIPHK----AQGKYRLSARSKILFNYDEFWQENQGEYR-HNYWQLPLHIERKQLEDIASKKRSMYRKRYEMLDQMALDIQQ 290
                  *******....799***********************855.55**********************************999985 PP



Or compare VIMSS858671 to CDD or PaperBLAST