PaperBLAST – Find papers about a protein or its homologs

 

Align WP_005649364.1 to PF04393 (DUF535)

WP_005649364.1 has 291 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    8.8e-94  299.9   8.5      1e-93  299.7   8.5    1.0  1  WP_005649364.1  


Domain annotation for each sequence (and alignments):
>> WP_005649364.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  299.7   8.5     1e-93     1e-93       3     281 .]      25     290 ..      23     290 .. 0.98

  Alignments for each domain:
  == domain 1  score: 299.7 bits;  conditional E-value: 1e-93
          DUF535   3 wkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqellekkgltlae 97 
                     +k++r++l+++ +++l+++q+++l++fln+++++++l+++  ++ +++l+++++k++sa++rl+ai+++++++ee+++++l+q+ll+++++ l++
  WP_005649364.1  25 LKQVREKLRYYGYKWLYQKQCHQLVDFLNTETQWQSLFTQDYYRTNTILTTFCDKRFSASERLTAITENLRLAEEKMGRSLCQQLLDQQHIVLTQ 119
                     6899******************************************************************************************9 PP

          DUF535  98 legkeeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGlrPkrLllealkllae 192
                          +e+l+l+Lsin+ ++ EG++s+++r+++++++y+++Ft+l   + ++llI+++QGp+++na+el+kq+TKa+hG+rP+++l++a+k+lae
  WP_005649364.1 120 ----LTEDLRLSLSINHIDPFEGYFSINIRNQNNERVYDASFTFL---SPNKLLIASIQGPSSDNAQELVKQATKALHGMRPMFMLVNAFKMLAE 207
                     ....99***************************************...889******************************************** PP

          DUF535 193 algveqilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseYrkRyalldeleeqiae 281
                     ++++ +++++++k     q +yrl+ ++k++++YdefW+e++Ge + ++y++LPl++erk+le+iaskKRs+YrkRy++ld+++  i++
  WP_005649364.1 208 KWQC-ELVGIPHK----AQGKYRLSARSKILFNYDEFWQENQGEYR-HNYWQLPLDIERKQLEDIASKKRSMYRKRYEMLDQMALDIQQ 290
                     ****.********....799***********************855.55**********************************999985 PP



Or compare WP_005649364.1 to CDD or PaperBLAST