PaperBLAST – Find papers about a protein or its homologs

 

Align ecocyc::G6460-MONOMER to PF04393 (DUF535)

ecocyc::G6460-MONOMER has 330 amino acids

Query:       DUF535  [M=281]
Accession:   PF04393.13
Description: Protein of unknown function (DUF535)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
   4.8e-104  333.6   2.3   5.6e-104  333.4   2.3    1.0  1  ecocyc::G6460-MONOMER  


Domain annotation for each sequence (and alignments):
>> ecocyc::G6460-MONOMER  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  333.4   2.3  5.6e-104  5.6e-104       2     280 ..      48     325 ..      47     326 .. 0.99

  Alignments for each domain:
  == domain 1  score: 333.4 bits;  conditional E-value: 5.6e-104
                 DUF535   2 kwkelrrrlkfllrsllhprqtkkllqflnqspllkellkkqprllekllrpYlsknlsakqrleaivdhytfleelltaellqelle 89 
                            +w+++++r kfllrsl++pr   +++++l+++p+l+ ll++qprl+ +l+rpYl++nls+kq lea+++hy++l+e+++ae ++ +l+
  ecocyc::G6460-MONOMER  48 FWHRRSFRQKFLLRSLIMPRLSVEWMNELSHWPNLNVLLTRQPRLPVRLHRPYLAANLSRKQLLEALRYHYALLRECMSAEEFSLYLN 135
                            79************************************************************************************** PP

                 DUF535  90 kkgltlaelegkeeeeleleLsinagqrkEGelsLelrdedkqllysltFtllkregektllIGalQGpkkenakelikqlTKachGl 177
                            + gl+la+legk++e+++leL+++ + +kEG  ++ +r++++ +l+++tFtl++++g++t++IG+lQG+k e +++ i+++TKachGl
  ecocyc::G6460-MONOMER 136 TPGLQLAKLEGKNGEQFTLELTMMISMDKEGDSTILFRNSEGIPLAEITFTLCEYQGKRTMFIGGLQGAKWEIPHQEIQNATKACHGL 223
                            **************************************************************************************** PP

                 DUF535 178 rPkrLllealkllaealgveqilavsnkghvyrqlryrlkkkkklvadYdefWeelgGeakdkeyyeLPleeerkdleeiaskKRseY 265
                            +PkrL++ea++l+a++l+veqi+avsn++h+yr+lryr +k+ k++adY++fWe++gG ++++++y+LP +++rk+++eiaskKR+eY
  ecocyc::G6460-MONOMER 224 FPKRLVMEAACLFAQRLQVEQIIAVSNETHIYRSLRYR-DKEGKIHADYNAFWESVGGVCDAERHYRLPAQIARKEIAEIASKKRAEY 310
                            *************************************7.************************************************* PP

                 DUF535 266 rkRyalldeleeqia 280
                            r+Ry++ld ++ q+a
  ecocyc::G6460-MONOMER 311 RRRYEMLDAIQPQMA 325
                            ***********9997 PP



Or compare ecocyc::G6460-MONOMER to CDD or PaperBLAST