PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS12564 to PF04402 (SIMPL)

VIMSS12564 has 250 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.9e-40  125.6   6.9    2.2e-40  125.4   6.9    1.0  1  VIMSS12564  


Domain annotation for each sequence (and alignments):
>> VIMSS12564  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  125.4   6.9   2.2e-40   2.2e-40       1     199 [.      48     247 ..      48     248 .. 0.93

  Alignments for each domain:
  == domain 1  score: 125.4 bits;  conditional E-value: 2.2e-40
       SIMPL   1 ItVtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklgev 99 
                 +tVtG+a+ +v+  + + +l+ve+++++a+++++++ae++n+++++l+++ +  +++qt++l+l+p+y y+n++++++gy  s++++++    d++g++
  VIMSS12564  48 LTVTGQASESVPTTLTEAQLTVEVQADTADQVQTAIAERSNRLVAYLRSQRV--DKLQTQGLQLQPNYVYSNNERRLEGYIGSNTVSFQY-PSDQVGKI 143
                 69**********************************************7666..459******************************998.8899**** PP

       SIMPL 100 ldaavka.aneingvsf.slsde.delrdeareeAvkdArakAealAkalgvklgkvvsisesgsnpyappapamaaaaaa.aasaatpfepgeievta 194
                 ld+av a a +i+g++f    ++ ++++++a+ +A++dA+a+A+++ ++l+++ +++v+i +++s+++++p  + a aa+  a+sa+tp+ +g+++v+a
  VIMSS12564 144 LDEAVRAgASRIDGIRFiATPETlKAAEQKALVAATADAQAQARVVLSSLNLTPQNIVRIVINPSPDQPMPLFRGALAASPmAESAPTPIISGDQTVQA 242
                 *******999*******776666889999*******************************9988888888888777777778***************** PP

       SIMPL 195 sVtvv 199
                 +Vt +
  VIMSS12564 243 TVTLE 247
                 **986 PP



Or compare VIMSS12564 to CDD or PaperBLAST