PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS142181 to PF04402 (SIMPL)

VIMSS142181 has 234 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-26   79.8   1.7    2.3e-26   79.6   1.7    1.0  1  VIMSS142181  


Domain annotation for each sequence (and alignments):
>> VIMSS142181  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   79.6   1.7   2.3e-26   2.3e-26       3     199 ..      29     231 ..      27     234 .] 0.75

  Alignments for each domain:
  == domain 1  score: 79.6 bits;  conditional E-value: 2.3e-26
        SIMPL   3 VtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklgevl 100
                   + sa ve+++D+++ +++v++eg+d +++ ae  +k n+ +   k+ + k++ ++ s     p+y+y ng++  tg+e +++++v+ r++d+l++++
  VIMSS142181  29 FSESAGVEAVQDTMSARFQVTAEGRDKNAVNAEFVKKFNNFTRKSKNGSFKTELVSRSA---MPRYQYTNGRRIQTGWEERAEFKVEGRNFDALNRFI 123
                  566899**************************************997335665444444...4*********************************** PP

        SIMPL 101 daavka.aneingvsfslsde..delrdeareeAvkdArakAealAkalgvklgkvvsise....sgsnp........yappapamaaaaaa....aa 179
                  +++++  a  +++ +f +s e  +e  d++ ++Av  ++a+Ae+lA  lg++  k+v+++     s   +        +++ +++++aa+      a+
  VIMSS142181 124 ADVQADaA--LEYTDFHVSRErrNEVIDQVSKDAVLRFKARAEKLAGVLGASGYKIVKLNLghigS---HiagggaaqAKMLRAMPMAAS-VnmegAD 215
                  77766433..99999999933346666677777**************9999888999999855542...144555553333333333333.2465555 PP

        SIMPL 180 saatpfepgeievtasVtvv 199
                  saa+ +e    e++ sV+ +
  VIMSS142181 216 SAAPGVE----EISISVNGT 231
                  5555544....777777654 PP



Or compare VIMSS142181 to CDD or PaperBLAST