PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS17001 to PF04402 (SIMPL)

VIMSS17001 has 246 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    8.9e-49  152.8   6.9      1e-48  152.6   6.9    1.0  1  VIMSS17001  


Domain annotation for each sequence (and alignments):
>> VIMSS17001  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  152.6   6.9     1e-48     1e-48       1     200 []      30     230 ..      30     230 .. 0.96

  Alignments for each domain:
  == domain 1  score: 152.6 bits;  conditional E-value: 1e-48
       SIMPL   1 ItVtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklgev 99 
                 I  +G+a+v ++pD+atl ++v + +kdaa+ak++++e++++ +++l+ + i++kdi++++l+++p+y+y++gk  ++gy+a ++++v++r+ldkl+++
  VIMSS17001  30 IVTSGTASVDAVPDIATLAIEVNVAAKDAATAKKQADERVAQYISFLELNQIAKKDISSANLRTQPDYDYQDGKSILKGYRAVRTVEVTLRQLDKLNSL 128
                 5679********************************************889************************************************ PP

       SIMPL 100 ldaavka.aneingvsfslsdedelrdeareeAvkdArakAealAkalgvklgkvvsisesgsnpyappapamaaaaaaaasaatpfepgeievtasVt 197
                 ld a+ka  nei++vs++++++d+++d+ar++A+++A+++A++lA  + +klg+v+s+++  sn++++p+ +m+ a aa +sa++ +e   i++  +V 
  VIMSS17001 129 LDGALKAgLNEIRSVSLGVAQPDAYKDKARKAAIDNAIHQAQELANGFHRKLGPVYSVRYHVSNYQPSPMVRMMKADAAPVSAQETYEQAAIQFDDQVD 227
                 ************************************************************7777888888888888888999999999999******** PP

       SIMPL 198 vvf 200
                 vvf
  VIMSS17001 228 VVF 230
                 *98 PP



Or compare VIMSS17001 to CDD or PaperBLAST