PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2021625 to PF04402 (SIMPL)

VIMSS2021625 has 235 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    7.7e-49  153.0   6.9    8.8e-49  152.8   6.9    1.0  1  VIMSS2021625  


Domain annotation for each sequence (and alignments):
>> VIMSS2021625  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  152.8   6.9   8.8e-49   8.8e-49       1     200 []      19     219 ..      19     219 .. 0.96

  Alignments for each domain:
  == domain 1  score: 152.8 bits;  conditional E-value: 8.8e-49
         SIMPL   1 ItVtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklg 97 
                   I  +G+a+v ++pD+atl ++v + +kdaa+ak++++e++++ +++l+ + i++kdi++++l+++p+y+y++gk  ++gy+a ++++v++r+ldkl+
  VIMSS2021625  19 IVTSGTASVDAVPDIATLAIEVNVAAKDAATAKKQADERVAQYISFLELNQIAKKDISSANLRTQPDYDYQDGKSILKGYRAVRTVEVTLRQLDKLN 115
                   5679********************************************889********************************************** PP

         SIMPL  98 evldaavka.aneingvsfslsdedelrdeareeAvkdArakAealAkalgvklgkvvsisesgsnpyappapamaaaaaaaasaatpfepgeievt 193
                   ++ld a+ka  nei++vs++++++d+++d+ar++A+++A+++A++lA  + +klg+v+s+++  sn++++p+ +m+ a aa +sa++ +e   i++ 
  VIMSS2021625 116 SLLDGALKAgLNEIRSVSLGVAQPDAYKDKARKAAIDNAIHQAQELANGFHRKLGPVYSVRYHVSNYQPSPMVRMMKADAAPVSAQETYEQAAIQFD 212
                   **************************************************************7777888888888888888999999999999**** PP

         SIMPL 194 asVtvvf 200
                    +V vvf
  VIMSS2021625 213 DQVDVVF 219
                   *****98 PP



Or compare VIMSS2021625 to CDD or PaperBLAST