PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS266811 to PF04402 (SIMPL)

VIMSS266811 has 223 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.5e-42  131.7   3.3    2.9e-42  131.5   3.3    1.0  1  VIMSS266811  


Domain annotation for each sequence (and alignments):
>> VIMSS266811  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  131.5   3.3   2.9e-42   2.9e-42       1     200 []      23     220 ..      23     220 .. 0.90

  Alignments for each domain:
  == domain 1  score: 131.5 bits;  conditional E-value: 2.9e-42
        SIMPL   1 ItVtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklge 98 
                  ItV+G++ v+++p++++lt+++++++k++++a++e+a +++++l+alk+lgi++kdi+t s+++ p+y+y n+k+ ++gy++++ +++++ + +k+ge
  VIMSS266811  23 ITVQGEGIVKAKPNVVILTIGIRTDSKNVKQAQEENAVQSKQLLDALKQLGIADKDIETISYTITPQYEYVNDKALLQGYRVEHLYEITVLNVQKAGE 120
                  9*****************************************************************************************88888*** PP

        SIMPL  99 vldaavka.aneingvsfslsdedelrdeareeAvkdArakAealAkalgvklgkv.vsise.sgsnpyappapamaaaaaa..aasaatpfepgeie 191
                  v+d av++ an   g++f++s++++++++a+ +A+++A +kA+a+A++ ++ + +v +s  e s++ p     ++  +   a   a+aa+p+++ge e
  VIMSS266811 121 VYDIAVSNgANVAKGLRFRISHPNKYYEQALIQALQQAVEKARAIASTYNLNINPVpLSFVEeSAQLP-----REVTSY--AtlHAQAAPPIQSGELE 211
                  ********999888**********************************99999877766655222222.....222222..2458999********** PP

        SIMPL 192 vtasVtvvf 200
                  +  ++++ f
  VIMSS266811 212 IISTIRAIF 220
                  ***999887 PP



Or compare VIMSS266811 to CDD or PaperBLAST