PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS305257 to PF04402 (SIMPL)

VIMSS305257 has 246 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-48  151.7   6.6    2.3e-48  151.5   6.6    1.0  1  VIMSS305257  


Domain annotation for each sequence (and alignments):
>> VIMSS305257  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  151.5   6.6   2.3e-48   2.3e-48       1     200 []      30     230 ..      30     230 .. 0.96

  Alignments for each domain:
  == domain 1  score: 151.5 bits;  conditional E-value: 2.3e-48
        SIMPL   1 ItVtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklge 98 
                  I  +G+a+v ++pD+atl ++v + +kdaa+ak++++e++++ +++l+ + i++kdi++++l+++p+y+y++gk  ++gy+a ++++v++r+ldkl++
  VIMSS305257  30 IVTSGTASVDAVPDIATLAIEVNVAAKDAATAKKQADERVAQYISFLELNQIAKKDISSANLRTQPDYDYQDGKSILKGYRAVRTVEVTLRQLDKLNS 127
                  5679********************************************889*********************************************** PP

        SIMPL  99 vldaavka.aneingvsfslsdedelrdeareeAvkdArakAealAkalgvklgkvvsisesgsnpyappapamaaaaaaaasaatpfepgeievtas 195
                  +ld a+ka  nei++vs++++++d+++d+ar++A+++A+++A++lA  + +klg+v+s+++  sn++++p+ +m+ a aa +sa++ +e   i++  +
  VIMSS305257 128 LLDGALKAgLNEIRSVSLGVAQPDAYKDKARKAAIDNAIHQAQELANGFHRKLGPVYSVRYHVSNYQPSPMVRMMKADAAPVSAQETYEQAAIQFDDQ 225
                  ************************************************************97777788888888888888999999999999999999 PP

        SIMPL 196 Vtvvf 200
                  V v f
  VIMSS305257 226 VDVIF 230
                  99987 PP



Or compare VIMSS305257 to CDD or PaperBLAST