PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS44752 to PF04402 (SIMPL)

VIMSS44752 has 238 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.5e-12   34.5   0.0    1.9e-12   34.2   0.0    1.1  1  VIMSS44752  


Domain annotation for each sequence (and alignments):
>> VIMSS44752  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.2   0.0   1.9e-12   1.9e-12       1     158 [.      45     204 ..      45     225 .. 0.82

  Alignments for each domain:
  == domain 1  score: 34.2 bits;  conditional E-value: 1.9e-12
       SIMPL   1 ItVtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldklgev 99 
                 ItV+G +e+e+ +   ++ l+ + +g++ ++  ++++  ++++ +++ k+g +e+ i+++    +    +e++k  +  y+a  sltv +++++k++++
  VIMSS44752  45 ITVKGLSEREILSTSSSWGLRYSLTGNTINDINKANNLSLSKIKSFFLKHGFSEDHIKMGFMEFN----EETYKESLYKYRAYISLTVHTKNIEKMEAA 139
                 9*********************************************9999**9999*99997773....4556777778*************9996665 PP

       SIMPL 100 ldaavkaaneingvsfsls.de.......delrdeareeAvkdArakAealAkalgvklgkvvsise 158
                  + +++  n  +g+ +s s  +       ++ + e++++ +++A+  A + Ak + +klgk+++ ++
  VIMSS44752 140 EKNIAELYN--QGILISNSgGPryyfdniNDIKPEMLADSIRNAKLAALEFAKHSSSKLGKIKNANQ 204
                 544434322..36666555322344444578899*********************9******98877 PP



Or compare VIMSS44752 to CDD or PaperBLAST