PaperBLAST – Find papers about a protein or its homologs

 

Align WP_015732219.1 to PF04402 (SIMPL)

WP_015732219.1 has 261 amino acids

Query:       SIMPL  [M=200]
Accession:   PF04402.14
Description: Protein of unknown function (DUF541)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      1e-33  103.6  10.2    1.2e-33  103.4  10.2    1.0  1  WP_015732219.1  


Domain annotation for each sequence (and alignments):
>> WP_015732219.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  103.4  10.2   1.2e-33   1.2e-33       1     200 []      48     258 ..      48     258 .. 0.85

  Alignments for each domain:
  == domain 1  score: 103.4 bits;  conditional E-value: 1.2e-33
           SIMPL   1 ItVtGsaevevapDqatltlsvesegkdaaeakaevaekmnavlealkklgikekdiqtsslslkpeysyengknkitgyeasqsltvkfrdldk 95 
                     I+V++s ++++a+D+++  +s+e +gkd +++++++ae+ + + e +k+l i++++++ +s+ ++ e+sy+n k+++ gy+a+qs+ +++ +++ 
  WP_015732219.1  48 IEVSASETKKFAADKFEMGFSLEIRGKDKESVSKRLAERRSVIFENVKSLEIPQSNVEQNSVEIHKEWSYRNSKRELVGYVATQSFVITV-NRKI 141
                     89**********************************************99****************************************.4444 PP

           SIMPL  96 .lgevldaavka.aneingvsfslsdedelrdeareeAvkdArakAealAkalgvklgkvvsise.....sgsnp......yappapamaaaaaa 177
                      ++++++a+++    ei+  s +l+d d+ ++ ++++A k+A akA+++A+ +g+klg+v++i+          +      y++   + aa+a++
  WP_015732219.1 142 dAAALVQALSSEpDVEIQRTSAQLKDVDAVQSTVIKAAGKKATAKANDYAEGVGAKLGRVLQINGegggiI---YnqynrvYRAKGVMLAANAMM 233
                     5889998999987779*********99************************************99654440...144555544444444444444 PP

           SIMPL 178 ...aasaatpfepgeievtasVtvvf 200
                        aa ++t+  ++ +ev+asV+vv+
  WP_015732219.1 234 dgaAAPDETA-IADSVEVSASVRVVY 258
                     7633344444.36778********98 PP



Or compare WP_015732219.1 to CDD or PaperBLAST