PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001015402.3 to PF04418 (DUF543)

NP_001015402.3 has 72 amino acids

Query:       DUF543  [M=74]
Accession:   PF04418.12
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      1e-23   69.4   0.2    1.1e-23   69.3   0.2    1.0  1  NP_001015402.3  


Domain annotation for each sequence (and alignments):
>> NP_001015402.3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   69.3   0.2   1.1e-23   1.1e-23      15      73 ..      10      68 ..       2      69 .. 0.91

  Alignments for each domain:
  == domain 1  score: 69.3 bits;  conditional E-value: 1.1e-23
          DUF543 15 sdldekwDaclsnllvkvglgllvGvvasvllfrrRaapvalGaGvGiGaAYtecsalF 73
                    +++ ++ D+c+s++l+k   g+++G ++s+l+ +rRa+pv+lGaG+G+G AY  c++  
  NP_001015402.3 10 EKICNRLDHCVSDVLIKGCGGVIIGSAVSFLILKRRAWPVWLGAGFGMGIAYRTCEKDL 68
                    5677899************************************************9876 PP



Or compare NP_001015402.3 to CDD or PaperBLAST