PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001264834.1 to PF04418 (DUF543)

NP_001264834.1 has 77 amino acids

Query:       DUF543  [M=74]
Accession:   PF04418.12
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.7e-28   83.7   0.7      4e-28   83.6   0.7    1.0  1  NP_001264834.1  


Domain annotation for each sequence (and alignments):
>> NP_001264834.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   83.6   0.7     4e-28     4e-28      15      73 ..       5      63 ..       1      64 [. 0.95

  Alignments for each domain:
  == domain 1  score: 83.6 bits;  conditional E-value: 4e-28
          DUF543 15 sdldekwDaclsnllvkvglgllvGvvasvllfrrRaapvalGaGvGiGaAYtecsalF 73
                     +l +kwD+cl+++ vk g+g++ G+v+sv++f+r+++p+a+G G+G+G+AY++c+  F
  NP_001264834.1  5 GELGRKWDRCLADSAVKLGAGFGLGIVFSVIFFKRKTWPIAFGSGMGLGMAYSNCQHDF 63
                    6799*****************************************************99 PP



Or compare NP_001264834.1 to CDD or PaperBLAST