PaperBLAST – Find papers about a protein or its homologs

 

Align NP_065435.1 to PF04418 (DUF543)

NP_065435.1 has 97 amino acids

Query:       DUF543  [M=74]
Accession:   PF04418.12
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.6e-37  111.7   0.1    8.3e-37  111.4   0.1    1.2  1  NP_065435.1  


Domain annotation for each sequence (and alignments):
>> NP_065435.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  111.4   0.1   8.3e-37   8.3e-37       5      74 .]      18      87 ..       3      87 .. 0.88

  Alignments for each domain:
  == domain 1  score: 111.4 bits;  conditional E-value: 8.3e-37
       DUF543  5 enakssapsesdldekwDaclsnllvkvglgllvGvvasvllfrrRaapvalGaGvGiGaAYtecsalFn 74
                  ++k++++++++ld+kwD++lsn+lvk+++g++vGv++svl+f+rRa+pv+lG+G+G+G++Y+e++a+F+
  NP_065435.1 18 DSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87
                 3346677777***********************************************************7 PP



Or compare NP_065435.1 to CDD or PaperBLAST